IL-4 Protein, Mouse

Cat. No.: HY-P70644: Data Sheet
COA

SDS
Handling Instructions
FAQs
Technical Support

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service Protein Expression Service

Size	Stock	Quantity
10 μg	In-stock	Estimated Time of Arrival: December 31
50 μg	In-stock	Estimated Time of Arrival: December 31
100 μg	In-stock	Estimated Time of Arrival: December 31
> 100 μg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

24 Publications Citing Use of MCE IL-4 Protein, Mouse

Flow Cytometry

2D/3D Cell Culture and Differentiation

Cell Proliferation/Viability Assay

: IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Nov 6:e15664. [Abstract]; Flow cytometric analysis of CD86 and CD206 expression in RAW264.7 cells and corresponding quantification (n = 3). M2 polarization of RAW264.7 cells was induced by treatment with recombinant IL-4 (20 ng/mL) for 24 h.

: IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2024 Dec 12:e2410495. [Abstract]; Flow cytometric analyzed the effect of IL-4 (20 ng/mL; 48 h)/IL-13 (40 ng/mL; 48 h) stimulation on M2 polarization of macrophages , and statistical analysis.

: IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2025 Apr 9;44(4):115542. [Abstract]; Mean currents elicited by membrane stretch (bottom traces) and recorded in the cell-attached configuration at −80 mV in BMDMs polarized to M2. BMDM M0 cells were first polarized to M2 in complete medium supplemented with IL-4 (20 ng/mL, HY-P70644) and IL-13 (20 ng/mL) cocktail for 24 h, and then treated with either EtOH (black traces) or 10 μM 7-KC (in red) for an additional 24 h in LDL-free medium. Left inset: M2 polarization was confirmed by CD206 gene expression and is represented as relative expression to TOP1. Right insets: peak current amplitude in EtOH (in black) or 7-KC (in red) condition, comparing WT and KO macrophages. n, number of individual recordings are shown above the traces. N = 2, number of animals from each genotype used for isolation of bone marrow mesenchymal stem cells and differentiation to macrophages.

: IL-4 Protein, Mouse purchased from MCE. Usage Cited in: J Agric Food Chem. 2024 May 16. [Abstract]; Cell viability of microglia treated with ox-LDL (12.5 μg/mL), FAC (200 μM), RSL3 (1 μM), erastin (5 μM), LPS (10 ng/mL), or IL-4 (10 ng/mL) for 24 h.

Biological Activity
Technical Parameters
Properties
Documentation
References

Description	IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag^[1]^[2]^[3].
Background	IL-4 is a core cytokine of the Th2-type immune response. As a pleiotropic cytokine, IL-4 is secreted by various cells such as Th2 cells, NKT cells, and mast cells. By binding to type I and type II receptors, IL-4 activates signaling pathways including JAK-STAT6, playing a central role in Th2 cell differentiation, B-cell immunoglobulin class switching (such as the production of IgE and IgG1), and M2 macrophage polarization. Aberrant expression of IL-4 is closely associated with allergic diseases like asthma and atopic dermatitis, as well as immune responses to parasitic infections^[1]^[2]^[3].
In Vitro	IL-4 Protein (Mouse; 0-10 ng/mL; 0-10 days) can prolong the survival time of mouse peritoneal exudate macrophages (PEM) in vitro. When used in combination with M-CSF (HY-P7050), it promotes cell proliferation, while when used in combination with GM-CSF (HY-P7361), it inhibits cell proliferation^[4]. IL-4 Protein (Mouse; 0-50 ng/mL; 48-120 h) can induce the proliferation of lymph node cells in BALB/c mice and induce Th2 differentiation and IL-4 production in CD4⁺ T cells of BALB/c mice^[5].
In Vivo	IL-4 protein (Mouse; 0.5-5 μg/kg; subcutaneous injection; 30 days) can improve psoriatic-like phenotypes, reduce inflammatory cell infiltration, decrease the expression of adhesion molecules, and exhibit activities in improving angiogenesis and inflammation in K14-VEGF transgenic mice^[6].
Biological Activity	1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED₅₀ for this effect is ≤250 pg/mL. 2. Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×10⁵ units/mg. Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×10⁵ units/mg.
Species	Mouse
Source	E. coli
Tag	Tag Free
Accession	P07750 (H23-S140)
Gene ID	16189 [NCBI]
Molecular Construction	N-term IL-4 (H23-S140) Accession # P07750 C-term
Protein Length	Full Length of Mature Protein
Synonyms	Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1
AA Sequence	HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Predicted Molecular Mass	13.4 kDa
Molecular Weight	Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
Purity	≥ 95%, as determined by reducing SDS-PAGE.
Appearance	Lyophilized powder
Formulation	1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% trehalose, pH 6.5. 2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose. Please refer to the lot-specific COA for specific buffer information.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (262 KB) SDS (252 KB) COA (220 KB) Handling Instructions (2659 KB)
References	[1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77. [Content Brief] [2]. Keegan AD, et al. Recent advances in understanding the role of IL-4 signaling. Fac Rev. 2021 Sep 7;10:71. [Content Brief] [3]. Choi P, et al. IL-4: role in disease and regulation of production. Clin Exp Immunol. 1998 Sep;113(3):317-9. [Content Brief] [4]. Chen BD, et al. Murine recombinant IL-4 is a bifunctional regulator of macrophage growth induced by colony-stimulating factors. J Immunol. 1992 Feb 1;148(3):753-9. [Content Brief] [5]. Myburgh E, et al. Murine IL-4 is able to signal via chimeric human IL-4Ralpha/mouse gamma-chain receptor. Mol Immunol. 2008 Mar;45(5):1327-36. [Content Brief] [6]. Ren X,et al. Recombinant murine interleukin 4 protein therapy for psoriasis in a transgenic VEGF mouse model. Dermatology. 2009;219(3):232-8. [Content Brief]