Copy Link Print Information

IL-4 Protein, Mouse

24 Cited Publications
Customer Review

Based on 24 publication(s) in Google Scholar

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • IL-4 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag[1][2][3].

Background

IL-4 is a core cytokine of the Th2-type immune response. As a pleiotropic cytokine, IL-4 is secreted by various cells such as Th2 cells, NKT cells, and mast cells. By binding to type I and type II receptors, IL-4 activates signaling pathways including JAK-STAT6, playing a central role in Th2 cell differentiation, B-cell immunoglobulin class switching (such as the production of IgE and IgG1), and M2 macrophage polarization. Aberrant expression of IL-4 is closely associated with allergic diseases like asthma and atopic dermatitis, as well as immune responses to parasitic infections[1][2][3].

In Vitro

IL-4 Protein (Mouse; 0-10 ng/mL; 0-10 days) can prolong the survival time of mouse peritoneal exudate macrophages (PEM) in vitro. When used in combination with M-CSF (HY-P7050), it promotes cell proliferation, while when used in combination with GM-CSF (HY-P7361), it inhibits cell proliferation[4].
IL-4 Protein (Mouse; 0-50 ng/mL; 48-120 h) can induce the proliferation of lymph node cells in BALB/c mice and induce Th2 differentiation and IL-4 production in CD4+ T cells of BALB/c mice[5].

In Vivo

IL-4 protein (Mouse; 0.5-5 μg/kg; subcutaneous injection; 30 days) can improve psoriatic-like phenotypes, reduce inflammatory cell infiltration, decrease the expression of adhesion molecules, and exhibit activities in improving angiogenesis and inflammation in K14-VEGF transgenic mice[6].

Verified Bioactivity

1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is ≤250 pg/mL.
2. Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×105 units/mg.

Results
  • Experimental Validation Results for IL-4 Protein, Mouse
    Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P07750 (H23-S140)

  • Gene ID
    16189  [NCBI]
  • Molecular Construction
    • N-term
    • IL-4 (H23-S140)
      Accession # P07750
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1

  • AA Sequence

    HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

  • Predicted Molecular Mass

    13.4 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IL-4 Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% trehalose, pH 6.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77. [Content Brief]

[2]. Keegan AD, et al. Recent advances in understanding the role of IL-4 signaling. Fac Rev. 2021 Sep 7;10:71. [Content Brief]

[3]. Choi P, et al. IL-4: role in disease and regulation of production. Clin Exp Immunol. 1998 Sep;113(3):317-9. [Content Brief]

[4]. Chen BD, et al. Murine recombinant IL-4 is a bifunctional regulator of macrophage growth induced by colony-stimulating factors. J Immunol. 1992 Feb 1;148(3):753-9. [Content Brief]

[5]. Myburgh E, et al. Murine IL-4 is able to signal via chimeric human IL-4Ralpha/mouse gamma-chain receptor. Mol Immunol. 2008 Mar;45(5):1327-36. [Content Brief]

[6]. Ren X,et al. Recombinant murine interleukin 4 protein therapy for psoriasis in a transgenic VEGF mouse model. Dermatology. 2009;219(3):232-8. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL

IL-4 Protein, Mouse Related Classifications

100 mg

Get Quote In-stock

Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.

  • 1/16

    IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Nov 6:e15664. [Abstract]

    Customer Validation
     Flow cytometric analysis of CD86 and CD206 expression in RAW264.7 cells and corresponding quantification (n = 3). M2 polarization of RAW264.7 cells was induced by treatment with recombinant IL-4 (20 ng/mL) for 24 h.

  • 1/16

    IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Dec 12:e2410495. [Abstract]

    Customer Validation
     Flow cytometric analyzed the effect of IL-4 (20 ng/mL; 48 h)/IL-13 (40 ng/mL; 48 h) stimulation on M2 polarization of macrophages , and statistical analysis.

  • 1/16

    IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2025 Apr 9;44(4):115542. [Abstract]

    Customer Validation
     Mean currents elicited by membrane stretch (bottom traces) and recorded in the cell-attached configuration at −80 mV in BMDMs polarized to M2. BMDM M0 cells were first polarized to M2 in complete medium supplemented with IL-4 (20 ng/mL, HY-P70644) and IL-13 (20 ng/mL) cocktail for 24 h, and then treated with either EtOH (black traces) or 10 μM 7-KC (in red) for an additional 24 h in LDL-free medium. Left inset: M2 polarization was confirmed by CD206 gene expression and is represented as relative expression to TOP1. Right insets: peak current amplitude in EtOH (in black) or 7-KC (in red) condition, comparing WT and KO macrophages. n, number of individual recordings are shown above the traces. N = 2, number of animals from each genotype used for isolation of bone marrow mesenchymal stem cells and differentiation to macrophages.

  • 1/16

    IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Agric Food Chem. 2024 May 16. [Abstract]

    Customer Validation
     Cell viability of microglia treated with ox-LDL (12.5 μg/mL), FAC (200 μM), RSL3 (1 μM), erastin (5 μM), LPS (10 ng/mL), or IL-4 (10 ng/mL) for 24 h.

  • IL-4 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • Experimental Validation Results for IL-4 Protein, Mouse
  • IL-4 Protein, Mouse Product Image

  • IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Nov 6:e15664. [Abstract]

    Flow cytometric analysis of CD86 and CD206 expression in RAW264.7 cells and corresponding quantification (n = 3). M2 polarization of RAW264.7 cells was induced by treatment with recombinant IL-4 (20 ng/mL) for 24 h.

  • IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2024 Dec 12:e2410495. [Abstract]

    Flow cytometric analyzed the effect of IL-4 (20 ng/mL; 48 h)/IL-13 (40 ng/mL; 48 h) stimulation on M2 polarization of macrophages , and statistical analysis.

  • IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Rep. 2025 Apr 9;44(4):115542. [Abstract]

    Mean currents elicited by membrane stretch (bottom traces) and recorded in the cell-attached configuration at −80 mV in BMDMs polarized to M2. BMDM M0 cells were first polarized to M2 in complete medium supplemented with IL-4 (20 ng/mL, HY-P70644) and IL-13 (20 ng/mL) cocktail for 24 h, and then treated with either EtOH (black traces) or 10 μM 7-KC (in red) for an additional 24 h in LDL-free medium. Left inset: M2 polarization was confirmed by CD206 gene expression and is represented as relative expression to TOP1. Right insets: peak current amplitude in EtOH (in black) or 7-KC (in red) condition, comparing WT and KO macrophages. n, number of individual recordings are shown above the traces. N = 2, number of animals from each genotype used for isolation of bone marrow mesenchymal stem cells and differentiation to macrophages.

  • IL-4 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Agric Food Chem. 2024 May 16. [Abstract]

    Cell viability of microglia treated with ox-LDL (12.5 μg/mL), FAC (200 μM), RSL3 (1 μM), erastin (5 μM), LPS (10 ng/mL), or IL-4 (10 ng/mL) for 24 h.