LAMP1/CD107a Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LAMP1/CD107a, a lysosomal membrane glycoprotein, assumes a crucial role in lysosome biogenesis, lysosomal pH regulation, autophagy, and cholesterol homeostasis. It serves as a direct inhibitor of the proton channel TMEM175, playing a pivotal role in lysosomal lumen pH regulation and facilitating optimal lysosomal acidification for efficient hydrolase activity. Additionally, LAMP1 is integral to NK-cell cytotoxicity, participating in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. Remarkably, it safeguards NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. LAMP1's involvement in presenting carbohydrate ligands to selectins, its role in tumor cell metastasis, and its interactions with proteins such as ABCB9 and FURIN underscore its multifaceted contributions to cellular processes. Notably, the interaction with TMEM175 highlights its inhibitory role in the proton channel activity of TMEM175, further emphasizing its regulatory function in lysosomal processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P11438 (L25-N370)
-
Molecular Construction
-
N-term
-
LAMP1 (L25-N370)
Accession # P11438 -
6*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
LAMP1; Lysosomal-Associated Membrane Protein 1; Lysosome Associated Membrane Protein 1; Lysosome-Associated Membrane Protein 1; Lysosomal Associated Membrane Protein 1; CD107a Antigen; CD107a; LGP120; Lysosome-Associated Membrane Glycoprotein 1; LAMP-1; C
-
AA Sequence
LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN
-
Predicted Molecular Mass
38.6 kDa
-
Molecular Weight
Approximately 55-110 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)