LAMP1/CD107a Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.

Background

LAMP1/CD107a, a lysosomal membrane glycoprotein, assumes a crucial role in lysosome biogenesis, lysosomal pH regulation, autophagy, and cholesterol homeostasis. It serves as a direct inhibitor of the proton channel TMEM175, playing a pivotal role in lysosomal lumen pH regulation and facilitating optimal lysosomal acidification for efficient hydrolase activity. Additionally, LAMP1 is integral to NK-cell cytotoxicity, participating in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. Remarkably, it safeguards NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. LAMP1's involvement in presenting carbohydrate ligands to selectins, its role in tumor cell metastasis, and its interactions with proteins such as ABCB9 and FURIN underscore its multifaceted contributions to cellular processes. Notably, the interaction with TMEM175 highlights its inhibitory role in the proton channel activity of TMEM175, further emphasizing its regulatory function in lysosomal processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LAMP1 (L25-N370)
      Accession # P11438
    • 6*His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    LAMP1; Lysosomal-Associated Membrane Protein 1; Lysosome Associated Membrane Protein 1; Lysosome-Associated Membrane Protein 1; Lysosomal Associated Membrane Protein 1; CD107a Antigen; CD107a; LGP120; Lysosome-Associated Membrane Glycoprotein 1; LAMP-1; C

  • AA Sequence

    LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

  • Predicted Molecular Mass

    38.6 kDa

  • Molecular Weight

    Approximately 55-110 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00