MCP-5/CCL12 Protein, Rat

The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free. The total length of MCP-5/CCL12 Protein, Rat is 68 a.a., with molecular weight of ~7.9 kDa.

MCP-5/CCL12 protein is a member of the intercrine beta (chemokine CC) family, categorizing it within a group of chemokines known for their role in intercellular communication and immune responses. As part of the intercrine beta family, MCP-5/CCL12 is likely involved in the modulation of inflammatory processes and cellular interactions. Further investigation is essential to unravel the specific functions and implications of MCP-5/CCL12 within the broader context of the chemokine CC family, shedding light on its significance in mediating immune responses and contributing to the intricate network of intercellular signaling.

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/mL.

Rat

E. coli

Tag Free

Q9QZU1 (G14-A81)

/

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Approximately 7.9 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.