MCP-5/CCL12 Protein, Rat
Based on 1 Customer Validation
The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free.
Background
MCP-5/CCL12 protein is a member of the intercrine beta (chemokine CC) family, categorizing it within a group of chemokines known for their role in intercellular communication and immune responses. As part of the intercrine beta family, MCP-5/CCL12 is likely involved in the modulation of inflammatory processes and cellular interactions. Further investigation is essential to unravel the specific functions and implications of MCP-5/CCL12 within the broader context of the chemokine CC family, shedding light on its significance in mediating immune responses and contributing to the intricate network of intercellular signaling.
Verified Bioactivity
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/mL.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9QZU1 (G14-A81)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CCL12 (G14-A81)
Accession # Q9QZU1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Scya12; Mcp5; Ccl12; Small-inducible cytokine A12; MCP-5; Monocyte chemotactic protein 5; Monocyte chemoattractant protein 5; MCP-1-related chemokine; C-C motif chemokine 12
-
AA Sequence
GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
-
Predicted Molecular Mass
7.9 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
