1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Nectin-2/CD112
  6. Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc)

Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc)

Cat. No.: HY-P78372
COA Handling Instructions

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc) is 329 a.a., with molecular weight of 70-80 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $56 In-stock
50 μg $120 In-stock
100 μg $205 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc) is 329 a.a., with molecular weight of 70-80 kDa.

Background

Nectin-2/CD112, a versatile modulator of T-cell signaling, exhibits dual roles as a costimulator or coinhibitor, contingent upon the receptor it engages. Binding to CD226 prompts the stimulation of T-cell proliferation and cytokine production, including key players like IL2, IL5, IL10, IL13, and IFNG. In contrast, interaction with PVRIG results in the inhibition of T-cell proliferation, and these engagements are competitive in nature. Additionally, Nectin-2/CD112 serves as a probable cell adhesion protein, as indicated in previous studies. Furthermore, in the context of microbial infection, it acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2), and pseudorabies virus (PRV).

Biological Activity

1.Immobilized Human PVRIG, mFc Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human Nectin-2, hFc Tag with the EC50 of 16.9ng/ml determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Human CD112 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human DNAM-1. The ED50 for this effect is 0.7498 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human CD112 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human DNAM-1. The ED50 for this effect is 0.7498 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q92692-2 /NP_002847.1(Q32-L360)

Gene ID
Molecular Construction
N-term
CD112 (Q32-L360)
Accession # Q92692-2/NP_002847.1
hFc
C-term
Synonyms
CD112; MPH; Nectin2; PRR2; PVRL2; HVEB; PVRR2
AA Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Molecular Weight

70-80 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nectin-2/CD112 Protein, Human (329a.a, HEK293, Fc)
Cat. No.:
HY-P78372
Quantity:
MCE Japan Authorized Agent: