PDGF-BB Protein, Human (His)

The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (His) is the recombinant human-derived PDGF-BB protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDGF-BB Protein, Human (His) is 109 a.a., with molecular weight of approximately 15 kDa.

GMP PDGF-BB Protein, a pivotal growth factor, assumes a central role in regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Renowned for its potent mitogenic effects on mesenchymal cells, GMP PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. Its vital contributions extend to the development of blood vessels and kidney glomeruli, highlighting its significance in vascular and renal physiology. A key participant in wound healing, GMP PDGF-BB's signaling dynamics are finely tuned through heterodimer formation with PDGFA. Present as an antiparallel homodimer, GMP PDGF-BB engages in disulfide-linked interactions with PDGFRA and PDGFRB homodimers, as well as with heterodimers formed by PDGFRA and PDGFRB. Additionally, it forms antiparallel heterodimers with PDGFA, further diversifying its regulatory repertoire. Notably, GMP PDGF-BB establishes connections with XLKD1, LRP1, and SORL1, contributing to a network of interactions that modulate its multifaceted functions.

Measured in a cell proliferation assay using NIH3T3 mouse fibroblast cells. The ED₅₀ for this effect is 5.712 ng/mL, corresponding to a specific activity is 1.751×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using NIH3T3 mouse fibroblast cells. The ED₅₀ for this effect is 5.712 ng/mL, corresponding to a specific activity is 1.751×10⁵ units/mg.

Human

E. coli

N-6*His

P01127 (S82-T190)

5155  [NCBI]

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.