1. Recombinant Proteins
  2. Biotinylated Proteins
  3. Protein L Protein, Finegoldia magna (Biotinylated, His-Avi)

Protein L Protein, Finegoldia magna (Biotinylated, His-Avi)

Cat. No.: HY-P78810
Handling Instructions Technical Support

L protein is derived from *Peptostreptococcus* and selectively binds to the immunoglobulin kappa light chain without interacting with the Fc region. This property can be used in antibody purification, diagnostics, and research to selectively isolate antibodies based on their light chain composition. Protein L Protein, Finegoldia magna (Biotinylated, His-Avi) is the recombinant protein L protein, expressed by E. coli , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

L protein is derived from *Peptostreptococcus* and selectively binds to the immunoglobulin kappa light chain without interacting with the Fc region. This property can be used in antibody purification, diagnostics, and research to selectively isolate antibodies based on their light chain composition. Protein L Protein, Finegoldia magna (Biotinylated, His-Avi) is the recombinant protein L protein, expressed by E. coli , with N-His, N-Avi labeled tag.

Background

Protein L is a bacterial immunoglobulin-binding protein produced by *Peptostreptococcus magnus*. It specifically binds to the kappa light chains of immunoglobulins (Ig) and does not interact with the Fc region. Protein L has applications in antibody purification, diagnostics, and research, where it enables the selective isolation of antibodies based on their light chain composition. This unique property makes Protein L a valuable tool in various biotechnological and biomedical applications involving antibody manipulation and analysis.

Biological Activity

Measured by its binding ability in a functional ELISA. Immoilized Ipilimumab antibody at 2 μg/mL can bind Biotinylated Protein L. The EC 50 is 1.123-1.761 ng/mL.

Species

Others

Source

E. coli

Tag

N-His;N-Avi

Accession

D6S9W1 (K106-G470)

Gene ID

/

Protein Length

Partial

Conjugation

Biotin

Synonyms
RPL; Protein L
AA Sequence

KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG

Predicted Molecular Mass
44.2 kDa
Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Protein L Protein, Finegoldia magna (Biotinylated, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Protein L Protein, Finegoldia magna (Biotinylated, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein L Protein, Finegoldia magna (Biotinylated, His-Avi)
Cat. No.:
HY-P78810
Quantity:
MCE Japan Authorized Agent: