YAP1 Protein, Human (P.pastoris, His)

YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (P.pastoris, His) is the recombinant human-derived YAP1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of YAP1 Protein, Human (P.pastoris, His) is 504 a.a., with molecular weight of ~68 kDa.

YAP1, a multifaceted transcriptional regulator, serves as a critical downstream target in the Hippo signaling pathway, orchestrating organ size control and tumor suppression by modulating proliferation and apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1, in coordination with SAV1, phosphorylate and activate LATS1/2, leading to the phosphorylation and inactivation of YAP1 and WWTR1/TAZ oncoproteins. YAP1 is pivotal in regulating tissue tension and 3D tissue shape by influencing cortical actomyosin network formation through ARHGAP18. Moreover, it plays a key role in controlling cell proliferation, with its nuclear translocation inhibited by LATS1/2 phosphorylation. YAP1's collaboration with TEAD transcription factors is essential for stimulating gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Additionally, it suppresses ciliogenesis by acting as a transcriptional corepressor of TEAD4 target genes AURKA and PLK1, and in conjunction with WWTR1, it regulates TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. YAP1 further activates the C-terminal fragment (CTF) of ERBB4 isoform 3.

Human

P. pastoris

N-6*His

P46937 (M1-L504)

10413  [NCBI]

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Approximately 68 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.