1. GPCR/G Protein
  2. GCGR
  3. GLP-1(7-36), amide acetate

GLP-1(7-36), amide acetate  (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate)

Cat. No.: HY-P0054 Purity: 99.01%
Handling Instructions Technical Support

GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CAS No. : 1119517-19-9

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 9 publication(s) in Google Scholar

Other Forms of GLP-1(7-36), amide acetate:

Top Publications Citing Use of Products

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968.  [Abstract]

    GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca2+ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425.  [Abstract]

    TB-59-2 is a potent agonist in the cAMP assay with a similar EC50 as the GLP-1(7-36), amide acetate (30 min) peptide.

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425.  [Abstract]

    TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.

    GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321.  [Abstract]

    Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.
    • Biological Activity

    • Purity & Documentation

    • References

    • Customer Review

    Description

    GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

    In Vitro

    Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36), amide acetate concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    In Vivo

    Gastric administration of glucose increases active GLP-1(7-36) amide levels in the portal blood after 10 min, followed by a marked decrease at 30 min. The gastric administration of TO also increases active GLP-1 levels after 10 min, and followed by a decrease to basal levels at 60 min. Individually, glucose and TO increase the secretion of GLP-1 in a dose-dependent manner. Furthermore, the co-administration of glucose and TO additively increase peak GLP-1 levels. CPE-administered mice have higher active GLP-1 levels in the portal blood at 10 and 30 min than those in the control mice. When glucose is administered with CPE, active GLP-1 and insulin levels in the portal blood are slightly higher in CPE-administered mice than in the control mice. High-fat diet-fed C57BL/6J mice develop hyperglycaemia and impair glucose tolerance[1].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Molecular Weight

    3297.64 (free base)

    Formula

    C149H226N40O45.xC2H4O2

    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

    Sequence Shortening

    HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Sealed storage, away from moisture and light

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

    Solvent & Solubility
    In Vitro: 

    H2O : 100 mg/mL (Need ultrasonic)

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo:

    For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
    The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

    • Protocol 1

      Add each solvent one by one:  PBS

      Solubility: 25 mg/mL; Clear solution; Need ultrasonic

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation

    Purity: 99.01%

    References
    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    GLP-1(7-36), amide acetate
    Cat. No.:
    HY-P0054
    Quantity:
    MCE Japan Authorized Agent: