GLP-1(7-36), amide TFA
Based on 11 publication(s) in Google Scholar
GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
For research use only. We do not sell to patients.
- Purity : 98.82%
- Formula: C149H226N40O45.xC2HF3O2
- Molecular Weight:3297.63 (free base)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) GLP-1(7-36), amide TFA
More- J Pharm Anal. 2024 Aug;14(8):100968. [Abstract]
- MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
- Stem Cell Reports. 2026 Aug 11;21(8):103008.
- Int J Pept Res Ther. 2026 Mar 10;32(2):38.
- Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
- bioRxiv. 2025 Nov 3.
- Research Square Preprint. 2024 Jan 9.
- Patent. US20230278991A1.
- Research Square Preprint. 2023 May 22.
- Patent. US20200283424A1.
- Patent. US20200283424A1.
-
Bio/Physico-chemical Assay
-
Bio/Physico-chemical Assay
-
Flow Cytometry
-
Cell Proliferation/Viability Assay
-
Flow Cytometry
Biological Activity
Description
In Vitro
Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3297.63 (free base)
-
Formula C149H226N40O45.xC2HF3O2
-
Color White to off-white
-
Synonyms
Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA; Human GLP-1 (7-36), amide TFA
-
Sequence
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (11)
-
Journal Impact Factor
-
Most Recent
-
J Pharm Anal
Baicalein: A potential GLP-1R agonist improves cognitive disorder of diabetes through mitophagy enhancement. [Abstract]2024 Aug;14(8):100968. PMID: 39258173
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968. [Abstract]
GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca2+ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.
-
MAbs
Functional GLP-1R antibodies identified from a synthetic GPCR-focused library demonstrate potent blood glucose control. [Abstract]2021 Jan-Dec;13(1):1893425. PMID: 33706686
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
TB-59-2 is a potent agonist in the cAMP assay with a similar EC50 as the GLP-1(7-36), amide acetate (30 min) peptide.
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]
TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.
-
-
-
Int J Endocrinol
GLP-1/GLP-1R Signaling Regulates Ovarian PCOS-Associated Granulosa Cells Proliferation and Antiapoptosis by Modification of Forkhead Box Protein O1 Phosphorylation Sites. [Abstract]2020 Jun 19:2020:1484321. PMID: 32655632
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.
GLP-1(7-36), amide TFA purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19:2020:1484321. [Abstract]
Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.
-
-
-
-
-
-
Solvent & Solubility
In Vitro:
DMSO : ≥ 50 mg/mL
H2O : 5 mg/mL (Need ultrasonic)
* "≥" means soluble, but saturation unknown.
In Vivo:
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: 10% DMSO 40% PEG300 5% Tween-80 45% Saline
Solubility: ≥ 1.25 mg/mL; Clear solution
This protocol yields a clear solution of ≥ 1.25 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (12.5 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.
Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: ≥ 1.25 mg/mL; Clear solution
This protocol yields a clear solution of ≥ 1.25 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (12.5 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
-
%DMSO +
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
-
%+
-
+%Tween-80 + +
-
%Saline +
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Working solution concentration: 0.22 mg/mL
Method for preparing stock solution: mg drug dissolved in μL DMSO. Stock solution concentration: mg/mL. * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
1. Take μL DMSO stock solution;
2. Add μL .
μL , mix evenly;
3. Then add μL Tween 80, mix evenly;
4. Then add μL
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Purity & Documentation
-
Data Sheet (284 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)