GLP-1(7-36), amide (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide)

Cat. No.: HY-P0054A: FAQs
Data Sheet Handling Instructions

Molarity Calculator

GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1(7-36), amide Chemical Structure

CAS No. : 107444-51-9

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of GLP-1(7-36), amide:

GLP-1(7-36), amide acetate GLP-1(7-36), amide TFA

Other Forms of GLP-1(7-36), amide:

GLP-1(7-36), amide acetate In-stock
GLP-1(7-36), amide TFA In-stock

7 Publications Citing Use of MCE GLP-1(7-36), amide

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description	GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
In Vitro	The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro^[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. GLP-1(7-36), amide Related Antibodies
In Vivo	Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects^[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration^[4]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight	3297.68
Formula	C₁₄₉H₂₂₆N₄₀O₄₅
CAS No.	107444-51-9
Sequence	His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence Shortening	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (265 KB) Handling Instructions (2659 KB)
References	[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief] [2]. Mentlein R, et al. Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum. Eur J Biochem. 1993 Jun 15;214(3):829-35. [Content Brief] [3]. Nauck MA, et al. Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7-36 amide) in type 2 (non-insulin-dependent) diabetic patients. Diabetologia. 1993 Aug;36(8):741-4. [Content Brief] [4]. Hansen L, et al. Glucagon-like peptide-1-(7-36)amide is transformed to glucagon-like peptide-1-(9-36)amide by dipeptidyl peptidase IV in the capillaries supplying the L cells of the porcine intestine. Endocrinology. 1999 Nov;140(11):5356-63. [Content Brief]

Cell Assay
^[4]

To test whether there is GLP-1-degrading activity in the perfusion medium itself, synthetic Glucagon-Like Peptide (GLP) I (7-36), amide is incubated (30 min at 37°C) in vitro with medium collected from the arterial line (i.e. before it passed through the tissue) and from the venous line, and subjected to HPLC and RIA analysis ^[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

[1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4. [Content Brief]

[2]. Mentlein R, et al. Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum. Eur J Biochem. 1993 Jun 15;214(3):829-35. [Content Brief]

[3]. Nauck MA, et al. Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7-36 amide) in type 2 (non-insulin-dependent) diabetic patients. Diabetologia. 1993 Aug;36(8):741-4. [Content Brief]

[4]. Hansen L, et al. Glucagon-like peptide-1-(7-36)amide is transformed to glucagon-like peptide-1-(9-36)amide by dipeptidyl peptidase IV in the capillaries supplying the L cells of the porcine intestine. Endocrinology. 1999 Nov;140(11):5356-63. [Content Brief]

GLP-1(7-36), amide Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GLP-1(7-36), amide107444-51-9Glucagon-like peptide-1 (GLP-1)(7-36), amide Human GLP-1 (7-36), amideGCGRGlucagon ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks