1. GPCR/G Protein
  2. Glucagon Receptor
  3. Glucagon-Like Peptide (GLP) I (7-36), amide, human

Glucagon-Like Peptide (GLP) I (7-36), amide, human (Synonyms: Human GLP-1-(7-36)-amide)

Cat. No.: HY-P0054A
Handling Instructions

Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion.

For research use only. We do not sell to patients.

Glucagon-Like Peptide (GLP) I (7-36), amide, human Chemical Structure

Glucagon-Like Peptide (GLP) I (7-36), amide, human Chemical Structure

CAS No. : 107444-51-9

Size Price Stock
500 μg USD 144 Ask For Quote & Lead Time
1 mg USD 240 Ask For Quote & Lead Time
5 mg USD 720 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Other In-stock Forms of Glucagon-Like Peptide (GLP) I (7-36), amide, human:

Other Forms of Glucagon-Like Peptide (GLP) I (7-36), amide, human:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion.

In Vitro

The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum[2].

In Vivo

Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration[4].

Molecular Weight

3297.68

Formula

C₁₄₉H₂₂₆N₄₀O₄₅

CAS No.

107444-51-9

SMILES

[HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2]

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glucagon-Like Peptide (GLP) I (7-36), amide, human
Cat. No.:
HY-P0054A
Quantity: