2. Peptides
  3. Teriparatide

Teriparatide  (Synonyms: Human parathyroid hormone-(1-34); hPTH (1-34))

Cat. No.: HY-P0059 Purity: 99.58%
COA Handling Instructions

Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Teriparatide Chemical Structure

Teriparatide Chemical Structure

CAS No. : 52232-67-4

Size Price Stock Quantity
Solid + Solvent
10 mM * 1 mL in Water
ready for reconstitution
 USD 503 In-stock
Solution
10 mM * 1 mL in Water USD 503 In-stock
Solid
1 mg USD 132 In-stock
5 mg USD 198 In-stock
10 mg USD 277 In-stock
50 mg USD 554 In-stock
100 mg USD 818 In-stock
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 3 publication(s) in Google Scholar

Other Forms of Teriparatide:

Teriparatide Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research[1].

IC50 & Target

IC50: 2 nM (PTH)[1].
In Vivo

Teriparatide (Human parathyroid hormone-(1-34)) (20 μg/kg, i.h.; daily, for 4 weeks; female New Zealand white rabbits) increases the cortical thickness and porosity[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Female New Zealand white rabbits[1]
Dosage: 20 μg/kg
Administration: Subcutaneous injection; daily, for 4 weeks
Result: Increased the pore ratio, number, and density as well as the cortical area, thickness, and bone mineral content (BMC), without significant influencing the volumetric bone mineral density (BMD).
Clinical Trial
Molecular Weight

4117.72

Appearance

Solid

Formula

C181H291N55O51S2
CAS No.
Sequence

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Sequence Shortening

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (24.29 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2429 mL 1.2143 mL 2.4285 mL
5 mM 0.0486 mL 0.2429 mL 0.4857 mL
10 mM 0.0243 mL 0.1214 mL 0.2429 mL
*Please refer to the solubility information to select the appropriate solvent.
In Vivo:
  • 1.

    Add each solvent one by one:  PBS

    Solubility: 50 mg/mL (12.14 mM); Clear solution; Need ultrasonic

*All of the co-solvents are available by MedChemExpress (MCE).
Purity & Documentation

Purity: 99.92%

COA (242 KB) RP-HPLC (140 KB) Elemental Analysis Report (100 KB)

Handling Instructions (2659 KB)
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Teriparatide52232-67-4Human parathyroid hormone-(1-34) hPTH (1-34)Othersparathyroid hormoneosteoporosisbone mineral contentcortical areaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Teriparatide
Cat. No.:
HY-P0059
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.