1. Others
  2. Others
  3. Teriparatide

Teriparatide (Synonyms: Human parathyroid hormone-(1-34); hPTH (1-34))

Cat. No.: HY-P0059 Purity: 99.58%
Handling Instructions

Teriparatide (Human parathyroid hormone-(1-34)) is a PHT agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research.

For research use only. We do not sell to patients.

Teriparatide Chemical Structure

Teriparatide Chemical Structure

CAS No. : 52232-67-4

Size Price Stock Quantity
Solution
10 mM * 1 mL in Water USD 503 In-stock
Estimated Time of Arrival: December 31
Solid + Solvent
10 mM * 1 mL
ready for reconstitution
USD 503 In-stock
Estimated Time of Arrival: December 31
Solid
1 mg USD 132 In-stock
Estimated Time of Arrival: December 31
5 mg USD 198 In-stock
Estimated Time of Arrival: December 31
10 mg USD 277 In-stock
Estimated Time of Arrival: December 31
50 mg USD 554 In-stock
Estimated Time of Arrival: December 31
100 mg USD 818 In-stock
Estimated Time of Arrival: December 31
200 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Teriparatide:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Teriparatide

  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Teriparatide (Human parathyroid hormone-(1-34)) is a PHT agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research[1].

IC50 & Target

IC50: 2 nM (PTH)[1].

In Vivo

Teriparatide (Human parathyroid hormone-(1-34)) (20 μg/kg, i.h.; daily, for 4 weeks; female New Zealand white rabbits) increases the cortical thickness and porosity[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Female New Zealand white rabbits[1]
Dosage: 20 μg/kg
Administration: Subcutaneous injection; daily, for 4 weeks
Result: Increased the pore ratio, number, and density as well as the cortical area, thickness, and bone mineral content (BMC), without significant influencing the volumetric bone mineral density (BMD).
Clinical Trial
Molecular Weight

4117.72

Formula

C181H291N55O51S2

CAS No.
Sequence

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Sequence Shortening

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

SMILES

[SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (24.29 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2429 mL 1.2143 mL 2.4285 mL
5 mM 0.0486 mL 0.2429 mL 0.4857 mL
10 mM 0.0243 mL 0.1214 mL 0.2429 mL
*Please refer to the solubility information to select the appropriate solvent.
Purity & Documentation

Purity: 99.92%

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Teriparatide
Cat. No.:
HY-P0059
Quantity:
MCE Japan Authorized Agent: