Teriparatide acetate hydrate
Based on 12 publication(s) in Google Scholar
Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) is a PTH1 receptor agonist. Teriparatide acetate hydrate (Human parathyroid hormone-(1-34) acetate hydrate) can be used for osteoporosis research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 99294-94-7
- Formule: C181H291N55O51S2.C2H4O2.xH2O
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Teriparatide acetate hydrate
More- Bone Res. 2026 Mar 17;14(1):31. [Abstract]
- Nat Commun. 2023 May 31;14(1):3159. [Abstract]
- Mater Today Bio. 2025 Sep 4:35:102272. [Abstract]
- J Orthop Translat. 2025 Jun 9:53:99-111. [Abstract]
- J Orthop Translat. 2022 Dec 7:38:241-255. [Abstract]
- Mater Des. 2025 Nov 15
- Biomedicines. 2025 Feb 3;13(2):342. [Abstract]
- J Cell Physiol. 2024 Aug;239(8):e31297. [Abstract]
- Tissue Cell. 2026 Jul 16;104(Pt 1):103791.
- Res Sq. 2025 Sep 24.
- bioRxiv. 2024 Jul 26:2024.07.26.605282. [Abstract]
- Biomed Pharmacother. 2019 Apr:112:108578. [Abstract]
Activité biologique
Description
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Female New Zealand white rabbits[1]
-
Dosage:20 μg/kg
-
Administration:Subcutaneous injection; daily, for 4 weeks
-
Result:Increased the pore ratio, number, and density as well as the cortical area, thickness, and bone mineral content (BMC), without significant influencing the volumetric bone mineral density (BMD).
Chemical Information
-
CAS No. 99294-94-7
-
Formule C181H291N55O51S2.C2H4O2.xH2O
-
SMILES
[SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (acetate salt, hydrate)]
-
Synonyms
Human parathyroid hormone-(1-34) acetate hydrate; hPTH (1-34) acetate hydrate
-
Sequence Shortening
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (12)
-
Journal Impact Factor
-
Most Recent
-
Bone Res
C/EBPβ dictates postmenopausal FSHβ transcription and blockade of AEP/C/EBPβ pathway alleviates osteoporosis. [Abstract]2026 Mar 17;14(1):31. PMID: 41844581 -
Nat Commun
An injectable liposome-anchored teriparatide incorporated gallic acid-grafted gelatin hydrogel for osteoarthritis treatment. [Abstract]2023 May 31;14(1):3159. PMID: 37258510 -
Mater Today Bio
An injectable phosphocreatine-grafted hydrogel incorporating hierarchically structured teriparatide/SrZnP-functionalized Zn-Cu particles for osteogenesis-angiogenesis coupling and osteoporotic bone regeneration. [Abstract]2025 Sep 4:35:102272. PMID: 40994624 -
J Orthop Translat
2025 Jun 9:53:99-111. PMID: 40538640 -
J Orthop Translat
Teriparatide ameliorates articular cartilage degradation and aberrant subchondral bone remodeling in DMM mice. [Abstract]2022 Dec 7:38:241-255. PMID: 36514714 -
-
Biomedicines
Effects of Teriparatide and Alendronate on Functional Recovery from Spinal Cord Injury and Postinjury Bone Loss. [Abstract]2025 Feb 3;13(2):342. PMID: 40002755 -
J Cell Physiol
Gprc5a is a novel parathyroid hormone-inducible gene and negatively regulates osteoblast proliferation and differentiation. [Abstract]2024 Aug;239(8):e31297. PMID: 38769895 -
-
-
bioRxiv
2024 Jul 26:2024.07.26.605282. PMID: 39091869 -
Biomed Pharmacother
The fast degradation of β-TCP ceramics facilitates healing of bone defects by the combination of BMP-2 and Teriparatide. [Abstract]2019 Apr:112:108578. PMID: 30784943
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)