EGF Protein, Human (Solution, HEK293, N-hFc)

The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (Solution, HEK293, N-hFc) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag. The total length of EGF Protein, Human (Solution, HEK293, N-hFc) is 53 a.a., with molecular weight of ~37 kDa.

The EGF Protein, a member of the epidermal growth factor superfamily, encodes a preproprotein that undergoes proteolytic processing to yield the 53-amino acid epidermal growth factor peptide. Functioning as a potent mitogenic factor, this protein plays a crucial role in the growth, proliferation, and differentiation of various cell types by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are associated with hypomagnesemia type 4, while dysregulation has been implicated in the growth and progression of certain cancers. Alternative splicing produces multiple transcript variants, including at least one encoding a preproprotein that undergoes proteolytic processing. Notably, the gene exhibits biased expression, with elevated levels in the kidney (RPKM 47.7), pancreas (RPKM 9.8), and one other tissue, highlighting its potential significance in these physiological contexts.

Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblast cells and the ED₅₀ is typically 0.3-1.5 ng/mL.

Human

HEK293

N-hFc

NP_001954.2 (N971-R1023)

1950  [NCBI]

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Approximately 37 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.