GST Protein, Schistosoma Japonicum

The GST (Glutathione S-transferase) protein is vital for conjugating reduced glutathione to hydrophobic electrophiles, essential for cellular detoxification and defense. GST isoenzymes play a central role in parasites' detoxification systems, indicating a crucial defense role. Additionally, GST may enhance haematin solubility in parasite guts, highlighting its multifaceted contributions to cellular and organismal processes. GST Protein, Schistosoma Japonicum is the recombinant GST protein, expressed by E. coli , with tag free.

The GST (Glutathione S-transferase) protein is integral to the cellular process of conjugating reduced glutathione to a diverse array of hydrophobic electrophiles, a crucial mechanism for detoxification and cellular defense. Beyond its role in general detoxification processes, GST isoenzymes are implicated as key components in the detoxification system of parasites, suggesting a central role in their defense mechanisms. Furthermore, there are indications that GST may have additional functions, such as enhancing the solubility of haematin in the gut of parasites, underscoring the multifaceted nature of its contributions to cellular and organismal processes.

Bio-activity is defined as the amount of enzyme that conjugate 1.0 μmole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at 37°C.

Materials
Test protein: GST Protein, Schistosoma Japonicum (HY-P70270)
Glutathione Transferase Activity Assay Kit

Procedure
1. Preheat the microplate reader for at least 30 minutes, setting the wavelength to 340 nm.
2. Preheat selected reagents at 37°C for 15 minutes as required.
3. Prepare sample group and blank group according to the following formula:
(Note: Dilute GST protein to 0.05 mg/mL with ddH₂O for use as sample)
Sample group: 20 μL sample, 180 μL Reagent II, 20 μL Reagent III;
Blank group: 20 μL Reagent I, 180 μL Reagent II, 20 μL Reagent III.
Add the above reagents to 96-well UV plates, mix promptly by pipetting, and record the absorbance value A1 at 340 nm at 10 seconds (A1 blank). Incubate at 37°C for 5 minutes in a water bath (or set the microplate reader to 37°C if temperature-controlled). Remove, dry thoroughly, and measure absorbance at 340 nm at 5 minutes 10 seconds (A2 blank).
4. Calculate enzyme activity based on protein concentration:
Bio-activity is defined as the amount of enzyme that conjugate 1.0 μmole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at at 37°C.

Others

E. coli

Tag Free

P08515 (M1-K218)

/

Full Length

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Approximately 25.0-28.0 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.