GST Protein, Schistosoma Japonicum

The GST (Glutathione S-transferase) protein is vital for conjugating reduced glutathione to hydrophobic electrophiles, essential for cellular detoxification and defense. GST isoenzymes play a central role in parasites' detoxification systems, indicating a crucial defense role. Additionally, GST may enhance haematin solubility in parasite guts, highlighting its multifaceted contributions to cellular and organismal processes. GST Protein, Schistosoma Japonicum is the recombinant GST protein, expressed by E. coli , with tag free. The total length of GST Protein, Schistosoma Japonicum is 218 a.a., with molecular weight of ~28.0 kDa.

The GST (Glutathione S-transferase) protein is integral to the cellular process of conjugating reduced glutathione to a diverse array of hydrophobic electrophiles, a crucial mechanism for detoxification and cellular defense. Beyond its role in general detoxification processes, GST isoenzymes are implicated as key components in the detoxification system of parasites, suggesting a central role in their defense mechanisms. Furthermore, there are indications that GST may have additional functions, such as enhancing the solubility of haematin in the gut of parasites, underscoring the multifaceted nature of its contributions to cellular and organismal processes.

<12 units/mg, is defined as the amount of enzyme that conjugate 1.0 u mole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at at 37°C.

Others

E. coli

Tag Free

P08515 (M1-K218)

/

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

Approximately 28.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.