1. Protein Tyrosine Kinase/RTK
  2. Insulin Receptor
  3. (Pro3) GIP, human

(Pro3) GIP, human  (Synonyms: (Pro3) Gastric Inhibitory Peptide, human)

Art. -Nr.: HY-P3584
Handling Instructions Technical Support

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Kundenspezifische Peptidsynthese

(Pro3) GIP, human

(Pro3) GIP, human Chemische Struktur

CAS. Nr. : 299898-52-5

Größe Verfügbarkeit
50 mg   Angebot einholen  
100 mg   Angebot einholen  
250 mg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of (Pro3) GIP, human:

Other Forms of (Pro3) GIP, human:

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Reinheit & Dokumentation

  • Verweise

  • Kundenbewertung

Beschreibung

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes[1][2].

IC50 & Target

EC50: 0.026 nM (hGIPR)[2]
Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)[2]

In Vitro

(Pro3) GIP, human induces cAMP accumulation with an EC50 value of 0.026 nM[2].
(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with Ki/ Kd values of 0.90 nM, 1.1 nM and 0.72 nM, respectively[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

(Pro3) GIP, human has comparatively weak partial agonist effect in rodent models[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molekulargewicht

4951.53

Formel

C226H338N60O64S

CAS. Nr.
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Sequence Shortening

YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Versand

Room temperature in continental US; may vary elsewhere.

Speicherung

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reinheit & Dokumentation
Verweise
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molaritätsrechner

  • Verdünnungsrechner

Die Formel zur Berechnung von Molaritäten

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Diese Gleichung wird häufig abgekürzt als: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Produktname

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
(Pro3) GIP, human
Art. -Nr.:
HY-P3584
Menge:
MCE Japan Authorized Agent: