1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins
  4. 2B4/CD244
  5. 2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi)

2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78912
Handling Instructions Technical Support

2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of 2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 200 a.a., with molecular weight of 65-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of 2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 200 a.a., with molecular weight of 65-80 kDa.

Background

The 2B4/CD244 protein demonstrates a higher affinity for binding to CD48 compared to isoform 1, and this interaction results in heightened cytotoxicity and intracellular calcium release. The stronger binding between 2B4/CD244 and CD48 suggests a more robust engagement, potentially leading to enhanced cellular responses, including increased cytotoxic activity and release of intracellular calcium.

Biological Activity

Immobilized Human CD48 Fc at 10 μg/mL (100 μL/well) can bind Biotinylated Human 2B4 Fc-Avi with a linear range of 0.01-0.156 μg/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

Q9BZW8-2 (C22-R221)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD244; 2B4; SLAMF4; NKR2B4; NAIL; h2B4
AA Sequence

CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Molecular Weight

65-80 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
2B4/CD244 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78912
Quantity:
MCE Japan Authorized Agent: