ACBD7 Protein, Human (His)
Based on 1 Customer Validation
ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag.
The ACBD7 Protein plays a pivotal role in cellular metabolism by binding with specificity to medium- and long-chain acyl-CoA esters. This unique capability suggests that ACBD7 may function as a molecular carrier for these acyl-CoA species, contributing to the intracellular transport and regulation of lipid metabolism. The selective binding of ACBD7 to acyl-CoA esters underscores its potential involvement in various cellular processes related to lipid homeostasis and energy metabolism.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q8N6N7 (M1-I88)
-
Molecular Construction
-
N-term
-
His
-
ACBD7 (M1-I88)
Accession # Q8N6N7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ACBD7; Acyl-CoA-Binding Domain-Containing Protein 7; Acyl-CoA Binding Domain Containing 7; Acyl-Coenzyme A Binding Domain Containing 7; BA455B2.2; FLJ38219
-
AA Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
