1. Recombinant Proteins
  2. Others
  3. ACBD7 Protein, Human (His)

ACBD7 Protein, Human (His)

Cat. No.: HY-P76709
SDS COA Handling Instructions

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag. The total length of ACBD7 Protein, Human (His) is 88 a.a., with molecular weight of ~10 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $70 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACBD7 Protein, pivotal in cellular metabolism, exhibits specific binding to medium- and long-chain acyl-CoA esters, hinting at a role as a molecular carrier for intracellular transport. This unique capability suggests ACBD7's involvement in regulating lipid metabolism, emphasizing its potential impact on cellular processes related to lipid homeostasis and energy metabolism. ACBD7 Protein, Human (His) is the recombinant human-derived ACBD7 protein, expressed by E. coli , with N-His labeled tag. The total length of ACBD7 Protein, Human (His) is 88 a.a., with molecular weight of ~10 kDa.

Background

The ACBD7 Protein plays a pivotal role in cellular metabolism by binding with specificity to medium- and long-chain acyl-CoA esters. This unique capability suggests that ACBD7 may function as a molecular carrier for these acyl-CoA species, contributing to the intracellular transport and regulation of lipid metabolism. The selective binding of ACBD7 to acyl-CoA esters underscores its potential involvement in various cellular processes related to lipid homeostasis and energy metabolism.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8N6N7 (M1-I88)

Gene ID
Molecular Construction
N-term
His
ACBD7 (M1-I88)
Accession # Q8N6N7
C-term
Synonyms
Acyl-CoA-binding domain-containing protein 7; ACBD7
AA Sequence

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGI

Molecular Weight

Approximately 10 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ACBD7 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACBD7 Protein, Human (His)
Cat. No.:
HY-P76709
Quantity:
MCE Japan Authorized Agent: