1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ACPS Protein, Streptococcus pyogenes serotype M28 (His)

ACPS Protein, Streptococcus pyogenes serotype M28 (His)

Cat. No.: HY-P72060A
SDS COA Handling Instructions

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag. The total length of ACPS Protein, Streptococcus pyogenes serotype M28 (His) is 118 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $147 In-stock
10 μg $250 In-stock
50 μg $700 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag. The total length of ACPS Protein, Streptococcus pyogenes serotype M28 (His) is 118 a.a., with molecular weight of ~15 kDa.

Background

ACPS, an essential enzyme in various cellular processes, operates by transferring the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

Q48RM7 (M1-K118)

Gene ID

/

Molecular Construction
N-term
6*His
ACPS (M1-K118)
Accession # Q48RM7
C-term
Synonyms
acpS; M28_Spy1523Holo-[acyl-carrier-protein] synthase; Holo-ACP synthase; EC 2.7.8.7; 4'-phosphopantetheinyl transferase AcpS
AA Sequence

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Molecular Weight

Approximately 15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 700 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ACPS Protein, Streptococcus pyogenes serotype M28 (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACPS Protein, Streptococcus pyogenes serotype M28 (His)
Cat. No.:
HY-P72060A
Quantity:
MCE Japan Authorized Agent: