1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. ACPS Protein, Streptococcus pyogenes serotype M28 (His)

ACPS Protein, Streptococcus pyogenes serotype M28 (His)

Cat. No.: HY-P72060A
Handling Instructions Technical Support

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag.

Background

ACPS, an essential enzyme in various cellular processes, operates by transferring the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

Q48RM7 (M1-K118)

Gene ID

/

Molecular Construction
N-term
6*His
ACPS (M1-K118)
Accession # Q48RM7
C-term
Protein Length

Full Length

Synonyms
acpS; M28_Spy1523Holo-[acyl-carrier-protein] synthase; Holo-ACP synthase; EC 2.7.8.7; 4'-phosphopantetheinyl transferase AcpS
AA Sequence

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Molecular Weight

Approximately 15 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 700 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ACPS Protein, Streptococcus pyogenes serotype M28 (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ACPS Protein, Streptococcus pyogenes serotype M28 (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACPS Protein, Streptococcus pyogenes serotype M28 (His)
Cat. No.:
HY-P72060A
Quantity:
MCE Japan Authorized Agent: