Adenylate Kinase 1/AK1 Protein, Human (His)

Adenylate Kinase 1/AK1 Protein is an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. AK1 is highly expressed in skeletal muscle, brain and erythrocytes. It facilitates cellular energy dynamics by catalyzing the reversible transfer of the terminal phosphate group between ATP and AMP. In addition, AK1 displays nucleoside diphosphate kinase activity. Adenylate Kinase 1/AK1 Protein, Human (His) is the recombinant human-derived Adenylate Kinase 1/AK1 protein, expressed by E. coli , with N-His labeled tag. The total length of Adenylate Kinase 1/AK1 Protein, Human (His) is 194 a.a., with molecular weight of ~23 kDa.

Adenylate Kinase 1/AK1 is an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. AK1 is highly expressed in skeletal muscle, brain and erythrocytes. It facilitates cellular energy dynamics by catalyzing the reversible transfer of the terminal phosphate group between ATP and AMP. In addition to its primary role, AK1 displays nucleoside diphosphate kinase activity, enabling the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP from their corresponding diphosphate substrates, utilizing either ATP or GTP as the phosphate donor. Furthermore, AK1 exhibits a low-rate catalysis for the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The multifunctional enzymatic activities of AK1 underscore its significance in maintaining adenylate nucleotide balance and its potential role in broader cellular processes, extending beyond traditional nucleotide metabolism^[1][2].

Specific activity is 120.42 pmol/min/μg. One unit will convert 1 pmoles of AMP and ATP to 2 pmoles of ADP per minute at 37°C.

Human

E. coli

N-6*His

AAH01116 (M1-K194)

203  [NCBI]

MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Approximately 23 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, 10% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.