1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Adiponectin
  5. Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His)

Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P700948
Handling Instructions Technical Support

Adiponectin/Acrp30 protein regulates fat metabolism and insulin sensitivity and has antidiabetic, antiatherosclerotic, and anti-inflammatory effects. It stimulates AMPK phosphorylation, enhancing glucose utilization and fatty acid burning. Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Adiponectin/Acrp30 protein regulates fat metabolism and insulin sensitivity and has antidiabetic, antiatherosclerotic, and anti-inflammatory effects. It stimulates AMPK phosphorylation, enhancing glucose utilization and fatty acid burning. Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-His labeled tag.

Background

Adiponectin/Acrp30 protein stands as a crucial adipokine with significant implications in the regulation of fat metabolism and insulin sensitivity, exerting direct anti-diabetic, anti-atherogenic, and anti-inflammatory effects. Its influence extends to the stimulation of AMPK phosphorylation and activation in the liver and skeletal muscle, thereby enhancing glucose utilization and fatty-acid combustion. Adiponectin/Acrp30 plays a pivotal role in dampening the pro-inflammatory effects of TNF-alpha by negatively regulating its expression in various tissues, including the liver and macrophages, and counteracting its downstream effects. Furthermore, it exhibits the ability to inhibit endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Beyond its metabolic functions, Adiponectin/Acrp30 may contribute to cell growth, angiogenesis, and tissue remodeling by binding and sequestering various growth factors, with distinct affinities depending on the type of complex formed—LMW, MMW, or HMW. Notably, the polymerization and secretion of adiponectin are subject to inhibition by succination of cysteine residues, a process mediated by the Krebs cycle intermediate fumarate, leading to the formation of S-(2-succinyl)cysteine residues. These intricate mechanisms highlight the multifaceted role of Adiponectin/Acrp30 in orchestrating metabolic, anti-inflammatory, and growth-related processes.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5X7X6 (Q48-N274)

Gene ID
Molecular Construction
N-term
Acrp30 (Q48-N274)
Accession # A0A2K5X7X6
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuAdiponectin, His; Acrp30; ADIPOQ
AA Sequence

QDTTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGVPGRDGRDGTPGEKGEKGDPGLIGPKGDTGETGVTGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTVPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Predicted Molecular Mass
25.8 kDa
Molecular Weight

Approximately 30-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adiponectin/Acrp30 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700948
Quantity:
MCE Japan Authorized Agent: