1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Adiponectin
  5. Adiponectin/Acrp30 Protein, Human (HEK293, His)

Adiponectin/Acrp30 Protein, Human (HEK293, His)

Cat. No.: HY-P70504
SDS COA Handling Instructions Technical Support

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Adiponectin/Acrp30 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Adiponectin/Acrp30 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Adiponectin/Acrp30 Protein, Human (HEK293, His) could increase cell sensitivity to insulin and can be used as a potential protein for treating diabetic tendinopathy[1].

Background

Recombinant Human Adiponectin can be used in the injured artery and attenuates vascular inflammatory response. It is reported that physiological concentrations of Recombinant Human Adiponectin suppress tumor necrosis factor-α(TNF-α)-induced endothelial adhesion molecule expression, transformation from macrophage to foam cell, and TNF-α expression in macrophages[1]. Recombinant Human Adiponectin can be used as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro[2].

Biological Activity

Measured by its ability to inhibit glucose production by rat hepatocytes. The ED50 for this effect is 5.936 µg/mL, corresponding to a specific activity is 168.46 units/mg.

  • Measured by its ability to inhibit glucose production by rat hepatocytes. The ED50 for this effect is 5.936 µg/mL, corresponding to a specific activity is 168.46 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q15848 (E19-N244)

Gene ID
Molecular Construction
N-term
Acrp30 (E19-N244)
Accession # Q15848
His
C-term
Synonyms
Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP3
AA Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Molecular Weight

32-40 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM Tris-HCL, 150 mM NaCL, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Adiponectin/Acrp30 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adiponectin/Acrp30 Protein, Human (HEK293, His)
Cat. No.:
HY-P70504
Quantity:
MCE Japan Authorized Agent: