Adiponectin/Acrp30 Protein, Bovine (P.pastoris, His)

Adiponectin/Acrp30 Protein, Bovine (P.pastoris, His) can increase cell sensitivity to insulin and can be used as a potential protein for diabetic tendinopathy research^[1].

Recombinant Human Adiponectin can be used in the injured artery and attenuates vascular inflammatory response. It is reported that physiological concentrations of Recombinant Human Adiponectin suppress tumor necrosis factor-α(TNF-α)-induced endothelial adhesion molecule expression, transformation from macrophage to foam cell, and TNF-α expression in macrophages^[1]. Recombinant Human Adiponectin can be used as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro^[2].

Bovine

P. pastoris

N-6*His

Q3Y5Z3 (E18-E240)

282865  [NCBI]

EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE

Approximately 27 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kumada M, et al. Adiponectin specifically increased tissue inhibitor of metalloproteinase-1 through interleukin-10 expression in human macrophages. Circulation. 2004 May 4;109(17):2046-9.  [Content Brief]

  [2]. Rothan HA, et al. Recombinant human adiponectin as a potential protein for treating diabetic tendinopathy promotes tenocyte progenitor cells proliferation and tenogenic differentiation in vitro. Int J Med Sci. 2013 Nov 27;10(13):1899-906.  [Content Brief]