ADORA1 Protein, Human (Cell-Free, His)

ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.

The ADORA1 Protein functions as a receptor for adenosine, and its activity is mediated by G proteins that inhibit adenylyl cyclase.

Human

E. coli Cell-free

N-10*His

P30542 (M1-D326)

134

Full Length

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Monomer: 36 kDa; Dimer: 80 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.