ADORA1 Protein, Human (Cell-Free, His)
Based on 1 Customer Validation
ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ADORA1 Protein, a receptor for adenosine, inhibits adenylyl cyclase through G proteins, modulating cellular activity. ADORA1 Protein, Human (Cell-Free, His) is the recombinant human-derived ADORA1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of ADORA1 Protein, Human (Cell-Free, His) is 326 a.a., with molecular weight of 39.3 kDa.
The ADORA1 Protein functions as a receptor for adenosine, and its activity is mediated by G proteins that inhibit adenylyl cyclase.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P30542 (M1-D326)
-
Gene ID134
-
Molecular Construction
-
N-term
-
10*His
-
ADORA1 (M1-D326)
Accession # P30542 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ADORA1; Adenosine Receptor A1; Adenosine A1 Receptor; RDC7
-
AA Sequence
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD
-
Predicted Molecular Mass
39.3 kDa
-
Molecular Weight
Approximately 36 kDa (Monomer) & 80 kDa (Dimer), based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
