AGR3 Protein, Mouse (HEK293, His)

AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.

Anterior gradient protein 3 (AGR3) is a homologue of the pro-oncogenic AGR2. AGR3 and AGR2 share a 71% sequence identity and lie adjacent to one another at chromosomal position 7p2. Functionally, they belong to the protein disulfide isomerases (PDIs) family, which act as endoplasmic reticulum (ER)-resident molecular foldases involved in the maintenance of cellular homeostasis. AGR3 is an ER resident protein, which is required for the regulation of ciliary beat frequency and mucociliary clearance in the airway epithelium. AGR3 was shown to interact with dystroglycan-1 (DAG-1) and metastasis-associated C4.4A protein, indicating its potential as a driver of metastasis. AGR3 is a potential promising target for anti-tumor therapy. Elevated AGR3 expression levels were reported in some cancer types, including breast, liver, prostate and ovary^[1].

Mouse

HEK293

C-6*His

Q8R3W7 (I21-L165)

403205  [NCBI]

IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSELHHHHHH

Approximately 16-18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris, 100 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Obacz J, et al. Extracellular AGR3 regulates breast cancer cells migration via Src signaling. Oncol Lett. 2019 Nov;18(5):4449-4456.  [Content Brief]