Copy Link Print Information

AGR3 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for AGR3 Protein, Mouse (HEK293, His)
  • AGR3 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.

Background

Anterior gradient protein 3 (AGR3) is a homologue of the pro-oncogenic AGR2. AGR3 and AGR2 share a 71% sequence identity and lie adjacent to one another at chromosomal position 7p2. Functionally, they belong to the protein disulfide isomerases (PDIs) family, which act as endoplasmic reticulum (ER)-resident molecular foldases involved in the maintenance of cellular homeostasis. AGR3 is an ER resident protein, which is required for the regulation of ciliary beat frequency and mucociliary clearance in the airway epithelium. AGR3 was shown to interact with dystroglycan-1 (DAG-1) and metastasis-associated C4.4A protein, indicating its potential as a driver of metastasis. AGR3 is a potential promising target for anti-tumor therapy. Elevated AGR3 expression levels were reported in some cancer types, including breast, liver, prostate and ovary[1].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8R3W7 (I21-L165)

  • Gene ID
    403205  [NCBI]
  • Molecular Construction
    • N-term
    • AGR3 (I21-L165)
      Accession # Q8R3W7
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    AGR3; Anterior Gradient Protein 3; Anterior Gradient 3, Protein Disulphide Isomerase Family Member; AG-3; BCMP11; AG3; PDIA18; Anterior Gradient 3 Homolog (Xenopus Laevis); HAG-3; Anterior Gradient Protein 3 Homolog; Protein Disulfide Isomerase Family A,

  • AA Sequence

    IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSEL

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 100 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Obacz J, et al. Extracellular AGR3 regulates breast cancer cells migration via Src signaling. Oncol Lett. 2019 Nov;18(5):4449-4456. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • AGR3 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for AGR3 Protein, Mouse (HEK293, His)
  • AGR3 Protein, Mouse (HEK293, His) Product Image