AGRP Protein, Mouse (HEK293, Fc)

The AGRP protein is critical for body weight homeostasis and regulates feeding behavior through the central melanocortin system. As an antagonist of alpha melanocyte-stimulating hormone, AGRP inhibits cAMP production through melanocortin receptors in the hypothalamus and adrenal glands. AGRP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with C-hFc labeled tag.

The AGRP protein plays a crucial role in maintaining weight homeostasis. It is involved in the regulation of feeding behavior through the central melanocortin system. AGRP acts as an antagonist of alpha melanocyte-stimulating hormone by inhibiting cAMP production mediated by the stimulation of melanocortin receptors in the hypothalamus and adrenal gland. It exhibits minimal activity with MC5R but functions as an inverse agonist for MC3R and MC4R, effectively suppressing their constitutive activity. AGRP also promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner. Furthermore, it interacts with melanocortin receptors MC3R, MC4R, and MC5R.

Mouse

HEK293

C-hFc

P56473 (V21-T131)

11604  [NCBI]

Full Length

VQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT

Approximately 41 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/colo-680n-cell.html