2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Peptide Hormone & Neuropeptides
  5. AGRP Protein, Rhesus Macaque (HEK293, Fc)

AGRP protein is an alpha-melanocyte stimulating hormone antagonist that regulates feeding behavior through the central melanocortin system to maintain body weight balance. AGRP inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal glands. AGRP can act as an inhibitor of MC3R and MC4R. AGRP Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived AGRP protein, expressed by HEK293 , with N-mFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

AGRP protein is an alpha-melanocyte stimulating hormone antagonist that regulates feeding behavior through the central melanocortin system to maintain body weight balance. AGRP inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal glands. AGRP can act as an inhibitor of MC3R and MC4R. AGRP Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived AGRP protein, expressed by HEK293 , with N-mFc labeled tag.
Background

AGRP protein plays a crucial role in body weight balance and regulates feeding behavior through the central melanocortin system. AGRP is an alpha-melanocyte stimulating hormone antagonist that inhibits cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal glands. AGRP can act as an inverse agonist of MC3R and MC4R, inhibiting their constituent activity. AGRP promotes endocytosis of MC3R and MC4R in an inhibitory dependent manner[1][2][3].
Species

Rhesus Macaque
Source

HEK293
Tag

N-mFc
Accession

XP_001091740 (S83-T132)
Gene ID
Molecular Construction
N-term
mFc
AGRP (S83-T132)
Accession # XP_001091740
C-term
Protein Length

Partial
Synonyms
Agouti-related protein; AGRP; AGRT; ART
AA Sequence

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Predicted Molecular Mass
32.3 kDa
Pureza

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentación
Instrucciones de manejo (2659 KB)

AGRP Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

AGRP Protein, Rhesus Macaque (HEK293, Fc)

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
AGRP Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P75566
Cantidad:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Country or Region *

Direcciòn del E-mail *

     

Número de teléfono *

 

Nombre de la Organizaciòn *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.