2. Recombinant Proteins
  3. Others
  4. AIF1 Protein, Bovine (N-His, C-Myc)

AIF1 Protein, Bovine (N-His, C-Myc)

Cat. No.: HY-P700529
Handling Instructions

AIF1 protein influences macrophage activation, modulating immune response and cellular activities. Its involvement implies broader influence on immune regulation and inflammation. Studying AIF1's mechanisms in macrophage activation can provide insights into its role in immune homeostasis and signaling pathways governing macrophage functions. AIF1 Protein, Bovine (N-His, C-Myc) is the recombinant bovine-derived AIF1 protein, expressed by E. coli, with C-Myc, N-10*His labeled tag. The total length of AIF1 Protein, Bovine (N-His, C-Myc) is 146 a.a., with molecular weight of 27.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AIF1 protein influences macrophage activation, modulating immune response and cellular activities. Its involvement implies broader influence on immune regulation and inflammation. Studying AIF1's mechanisms in macrophage activation can provide insights into its role in immune homeostasis and signaling pathways governing macrophage functions. AIF1 Protein, Bovine (N-His, C-Myc) is the recombinant bovine-derived AIF1 protein, expressed by E. coli, with C-Myc, N-10*His labeled tag. The total length of AIF1 Protein, Bovine (N-His, C-Myc) is 146 a.a., with molecular weight of 27.6 kDa.
Background

The AIF1 protein appears to be involved in macrophage activation and function, suggesting a potential role in modulating the immune response and cellular activities associated with macrophages. Its participation in macrophage function implies a broader influence on immune regulation and inflammatory responses. Further investigation into the specific mechanisms by which AIF1 contributes to macrophage activation could provide valuable insights into its role in immune homeostasis and the complex interplay of signaling pathways that govern macrophage functions in various physiological contexts.
Species

Bovine
Source

E. coli
Tag

C-Myc;N-10*His
Accession

Q9BDK2 (S2-P147)
Gene ID

280989  [NCBI]
Molecular Construction
N-term
10*His
AIF1 (S2-P147)
Accession # Q9BDK2
Myc
C-term
Synonyms
allograft inflammatory factor 1; IBA1; IRT1; AIF-1; IRT-1; protein G1;
AA Sequence

SETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLNEDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAREQEKPTGLPAKKAISELP

Molecular Weight

27.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

AIF1 Protein, Bovine (N-His, C-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AIF1 Protein, Bovine (N-His, C-Myc)
Cat. No.:
HY-P700529
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.