AIF1 Protein, Bovine (N-His, C-Myc)

AIF1 protein influences macrophage activation, modulating immune response and cellular activities. Its involvement implies broader influence on immune regulation and inflammation. Studying AIF1's mechanisms in macrophage activation can provide insights into its role in immune homeostasis and signaling pathways governing macrophage functions. AIF1 Protein, Bovine (N-His, C-Myc) is the recombinant bovine-derived AIF1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

The AIF1 protein appears to be involved in macrophage activation and function, suggesting a potential role in modulating the immune response and cellular activities associated with macrophages. Its participation in macrophage function implies a broader influence on immune regulation and inflammatory responses. Further investigation into the specific mechanisms by which AIF1 contributes to macrophage activation could provide valuable insights into its role in immune homeostasis and the complex interplay of signaling pathways that govern macrophage functions in various physiological contexts.

Bovine

E. coli

C-Myc;N-10*His

Q9BDK2 (S2-P147)

280989  [NCBI]

Full Length of Mature Protein

SETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLNEDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAREQEKPTGLPAKKAISELP

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.