AIF1 Protein, Bovine (N-His, C-Myc)
AIF1 protein influences macrophage activation, modulating immune response and cellular activities. Its involvement implies broader influence on immune regulation and inflammation. Studying AIF1's mechanisms in macrophage activation can provide insights into its role in immune homeostasis and signaling pathways governing macrophage functions. AIF1 Protein, Bovine (N-His, C-Myc) is the recombinant bovine-derived AIF1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
- Species: Bovine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AIF1 protein influences macrophage activation, modulating immune response and cellular activities. Its involvement implies broader influence on immune regulation and inflammation. Studying AIF1's mechanisms in macrophage activation can provide insights into its role in immune homeostasis and signaling pathways governing macrophage functions. AIF1 Protein, Bovine (N-His, C-Myc) is the recombinant bovine-derived AIF1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
Background
The AIF1 protein appears to be involved in macrophage activation and function, suggesting a potential role in modulating the immune response and cellular activities associated with macrophages. Its participation in macrophage function implies a broader influence on immune regulation and inflammatory responses. Further investigation into the specific mechanisms by which AIF1 contributes to macrophage activation could provide valuable insights into its role in immune homeostasis and the complex interplay of signaling pathways that govern macrophage functions in various physiological contexts.
Technical Parameters
-
Species Bovine
-
Source E. coli
-
Tag C-Myc;N-10*His
-
Accession
Q9BDK2 (S2-P147)
-
Molecular Construction
-
N-term
-
10*His
-
AIF1 (S2-P147)
Accession # Q9BDK2 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
AIF1; Interferon Gamma Responsive Transcript; Allograft Inflammatory Factor 1; Em:AF129756.17; AIF-1; Protein G1; IBA1; IRT1; Ionized Calcium-Binding Adapter Molecule 1; G1; IRT-1
-
AA Sequence
SETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLNEDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAREQEKPTGLPAKKAISELP
-
Predicted Molecular Mass
27.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
