1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His)

Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His)

Cat. No.: HY-P702145
Handling Instructions Technical Support

The alcohol dehydrogenase protein is part of the zinc-containing alcohol dehydrogenase family and catalyzes the oxidation of alcohol, which is critical in various metabolic processes. It is primarily active in the liver, where it converts ethanol into acetaldehyde during the breakdown of ethanol. Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His) is the recombinant Alcohol dehydrogenase protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The alcohol dehydrogenase protein is part of the zinc-containing alcohol dehydrogenase family and catalyzes the oxidation of alcohol, which is critical in various metabolic processes. It is primarily active in the liver, where it converts ethanol into acetaldehyde during the breakdown of ethanol. Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His) is the recombinant Alcohol dehydrogenase protein, expressed by E. coli , with N-6*His labeled tag.

Background

Alcohol dehydrogenase protein belongs to the zinc-containing alcohol dehydrogenase family, playing a crucial role in catalyzing the oxidation of alcohols to aldehydes or ketones. This protein is involved in various metabolic processes, including the breakdown of ethanol in the liver, where it converts ethanol to acetaldehyde. Additionally, alcohol dehydrogenase protein participates in the metabolism of other alcohols and xenobiotics, contributing to their detoxification and elimination from the body. Its enzymatic activity and expression levels can be influenced by genetic variations, environmental factors, and alcohol consumption patterns, thereby affecting an individual's susceptibility to alcohol-related disorders and responses to alcohol exposure. Overall, alcohol dehydrogenase protein represents an essential component in alcohol metabolism and the maintenance of cellular homeostasis.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

A0A1S6QHZ8 (M1-K345)

Gene ID

/

Molecular Construction
N-term
6*His
ADH (M1-K345)
Accession # A0A1S6QHZ8
C-term
Protein Length

Full Length

Synonyms
Alcohol dehydrogenase
AA Sequence

MKYQIPETMRAWQITTPGKIDGSKSPLELVTKPVPQPQRGEVLVRVLTCGVCHTDLHVTEGDLPVHKDHLTPGHEIVGEVVKQGPESSRFKLGDRIGIPWLRWTCGVCQYCRSGKENLCPNSLYTGWDHDGGYAEYATVPEGFAYRIPDRFDSQTAAPLLCAGIIGYRAFLRANIPAGGKLGLYGFGGSAHITAQLAIDQGMEVHVLTRGEDAKKFALKLGAKSVNGAYDLPPVKLDSSIIFAPVGDIVPKALEGLKPGGTLALAGIHMTDVPQISYQEHIFHEKNLTSVESNTRSDGEHFLTLADRLGIEPKTTPYPFEKADEALRYVSKGDIKGACVLKIGEK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Alcohol dehydrogenase Protein, Lentilactobacillus curieae (His)
Cat. No.:
HY-P702145
수량:
MCE Japan Authorized Agent: