Alcohol dehydrogenase Protein, Lentilactobacillus curieae

The alcohol dehydrogenase protein is part of the zinc-containing alcohol dehydrogenase family and catalyzes the oxidation of alcohol, which is critical in various metabolic processes. It is primarily active in the liver, where it converts ethanol into acetaldehyde during the breakdown of ethanol. Alcohol dehydrogenase Protein, Lentilactobacillus curieae is the recombinant Alcohol dehydrogenase protein, expressed by E. coli , with tag free.

Alcohol dehydrogenase protein belongs to the zinc-containing alcohol dehydrogenase family, playing a crucial role in catalyzing the oxidation of alcohols to aldehydes or ketones. This protein is involved in various metabolic processes, including the breakdown of ethanol in the liver, where it converts ethanol to acetaldehyde. Additionally, alcohol dehydrogenase protein participates in the metabolism of other alcohols and xenobiotics, contributing to their detoxification and elimination from the body. Its enzymatic activity and expression levels can be influenced by genetic variations, environmental factors, and alcohol consumption patterns, thereby affecting an individual's susceptibility to alcohol-related disorders and responses to alcohol exposure. Overall, alcohol dehydrogenase protein represents an essential component in alcohol metabolism and the maintenance of cellular homeostasis.

Others

E. coli

Tag Free

A0A1S6QHZ8 (M1-K345)

/

Full Length

MKYQIPETMRAWQITTPGKIDGSKSPLELVTKPVPQPQRGEVLVRVLTCGVCHTDLHVTEGDLPVHKDHLTPGHEIVGEVVKQGPESSRFKLGDRIGIPWLRWTCGVCQYCRSGKENLCPNSLYTGWDHDGGYAEYATVPEGFAYRIPDRFDSQTAAPLLCAGIIGYRAFLRANIPAGGKLGLYGFGGSAHITAQLAIDQGMEVHVLTRGEDAKKFALKLGAKSVNGAYDLPPVKLDSSIIFAPVGDIVPKALEGLKPGGTLALAGIHMTDVPQISYQEHIFHEKNLTSVESNTRSDGEHFLTLADRLGIEPKTTPYPFEKADEALRYVSKGDIKGACVLKIGEK

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.