ALDH1A2 Protein, Human (P.pastoris, His)
The ALDH1A2 protein catalyzes the NAD-dependent oxidation of aldehyde substrates, including all-trans -retinal and all-trans 13,14-dihydroretinal. ALDH1A2 Protein, Human (P.pastoris, His) is the recombinant human-derived ALDH1A2 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ALDH1A2 protein catalyzes the NAD-dependent oxidation of aldehyde substrates, including all-trans -retinal and all-trans 13,14-dihydroretinal. ALDH1A2 Protein, Human (P.pastoris, His) is the recombinant human-derived ALDH1A2 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
ALDH1A2 protein plays a pivotal role in the NAD-dependent oxidation of various aldehyde substrates, such as all-trans-retinal and all-trans-13,14-dihydroretinal, converting them into their corresponding carboxylic acids, namely all-trans-retinoate and all-trans-13,14-dihydroretinoate. This enzymatic activity is essential for retinoate signaling, a process critical for the transcriptional control of numerous genes and notably crucial for the initiation of meiosis in both male and female organisms. ALDH1A2 can recognize retinal as a substrate, whether in its free form or when bound to cellular retinol-binding protein. While displaying the capability to metabolize octanal and decanal, ALDH1A2 exhibits only minimal activity with benzaldehyde, acetaldehyde, and propanal. Interestingly, it completely lacks activity with citral.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
O94788 (M1-S518)
-
Molecular Construction
-
N-term
-
6*His
-
ALDH1A2 (M1-S518)
Accession # O94788 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ALDH1A2; RALDH 2; Aldehyde Dehydrogenase 1 Family Member A2; Aldehyde Dehydrogenase 1 Family, Member A2; RALDH2; Aldehyde Dehydrogenase Family 1 Member A2; Retinaldehyde-Specific Dehydrogenase Type 2; Retinaldehyde Dehydrogenase 2; Retinal Dehydrogenase 2
-
AA Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
-
Predicted Molecular Mass
58.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
