Allergin-1 Protein, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Allergin-1 Protein, an immunoglobulin-like receptor, functions as a negative regulator in mast cells by inhibiting degranulation. Specifically, it plays a crucial role in suppressing IgE-mediated mast cell activation, thereby dampening the type I immediate hypersensitivity reaction. Allergin-1 operates as a monomer and interacts with key signaling molecules, including tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that contribute to its inhibitory effects on mast cell degranulation.

Human

HEK293

C-6*His

Q7Z6M3-1 (R20-K227)

284021  [NCBI]

Extracellular Domain

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Approximately 40-57 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.