Alpha-crystallin A chain/CRYAA Protein, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms^[1].

Alpha-crystallin A chain/CRYAA Protein is a member of the small heat shock protein family that includes 10 proteins in humans characterized by a conserved-crystallin domain of ~90 amino acids in their C-terminal region. Point mutations in small heat shock protein genes are associated with pathological conditions such as cataracts and desmin-related myopathy^[1].

Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED₅₀ for this effect is 1.405 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED₅₀ for this effect is 1.405 μg/mL.

Human

E. coli

C-6*His

P02489 (M1-S173)

1409  [NCBI]

Full Length

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Approximately 20-23 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, 2 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Xi JH, et al. Mechanism of small heat shock protein function in vivo: a knock-in mouse model demonstrates that the R49C mutation in alpha A-crystallin enhances protein insolubility and cell death. J Biol Chem. 2008;283(9):5801-5814.  [Content Brief]