Alpha-crystallin A chain/CRYAA Protein, Human (His)
Based on 1 Customer Validation
Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].
Background
Alpha-crystallin A chain/CRYAA Protein is a member of the small heat shock protein family that includes 10 proteins in humans characterized by a conserved-crystallin domain of ~90 amino acids in their C-terminal region. Point mutations in small heat shock protein genes are associated with pathological conditions such as cataracts and desmin-related myopathy[1].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED50 for this effect is 1.405 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P02489 (M1-S173)
-
Molecular Construction
-
N-term
-
CRYAA (M1-S173)
Accession # P02489 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRYAA; Human AlphaA-Crystallin (CRYA1); Prev. CRYA1; Crystallin, Alpha A; HSPB4; Crystallin, Alpha-1; Alpha-Crystallin A Chain; CTRCT9; Heat Shock Protein Family B Member 4; HspB4; Heat Shock Protein Beta-4; Crystallin Alpha A; Alpha Crystallin A Chain
-
AA Sequence
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 2 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
