1. Recombinant Proteins
  2. Receptor Proteins
  3. Receptor Serine/Threonine Kinases
  4. Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
  5. AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P77560
Handling Instructions Technical Support

AMHR2/MISRII Protein is expressed in a large number of female reproductive organs. AMHR2 Protein, upon ligand binding, assembles a receptor complex with two type II and two type I transmembrane serine/threonine kinases. Type II receptors initiate the signaling cascade by phosphorylating and activating type I receptors, which undergo autophosphorylation. Activated type I receptors then engage and activate SMAD transcriptional regulators, modulating downstream gene expression. Furthermore, AMHR2 serves as the receptor for anti-Muellerian hormone. AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus, Rhesus Macaque-derived AMHR2/MISRII protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AMHR2/MISRII Protein is expressed in a large number of female reproductive organs. AMHR2 Protein, upon ligand binding, assembles a receptor complex with two type II and two type I transmembrane serine/threonine kinases. Type II receptors initiate the signaling cascade by phosphorylating and activating type I receptors, which undergo autophosphorylation. Activated type I receptors then engage and activate SMAD transcriptional regulators, modulating downstream gene expression. Furthermore, AMHR2 serves as the receptor for anti-Muellerian hormone. AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) is the recombinant cynomolgus, Rhesus Macaque-derived AMHR2/MISRII protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Anti-Muellerian hormone type-2 receptor (AMHR2) is expressed in a large number of female reproductive organs. And its expression is mainly regulated by bone morphogenetic proteins, gonadotropins, and estrogens. AMHR2, upon ligand binding, assembles a receptor complex with two type II and two type I transmembrane serine/threonine kinases. The type II receptors initiate the signaling cascade by phosphorylating and activating the type I receptors, which, in turn, undergo autophosphorylation. Subsequently, these activated type I receptors engage with and activate SMAD transcriptional regulators, culminating in the modulation of downstream gene expression. Notably, AMHR2 serves as the receptor for anti-Muellerian hormone, playing a pivotal role in mediating the cellular responses triggered by this hormone. Mutations in AMHR2 gene are associated with persistent Mullerian duct syndrome type II[1].

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_001105261 (P18-S144)

Gene ID
Molecular Construction
N-term
AMHR2 (P18-S144)
Accession # XP_001105261
hFc
C-term
Protein Length

Partial

Synonyms
MIS type II receptor; MISRII; MRII; AMHR; MISR2; AMHR2; AMH type II receptor; AMHR2; AMHRII; C14
AA Sequence

PPNRRTCVFFEAPGVQGSTKTLGELLDTGPELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Predicted Molecular Mass
40.2 kDa
Molecular Weight

Approximately 50-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMHR2/MISRII Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P77560
Quantity:
MCE Japan Authorized Agent: