AMHR2/MISRII Protein, Cynomolgus/Rhesus macaque (HEK293, His)

The AMHR2/MISRII protein assembles receptor complexes with two type II and two type I transmembrane serine/threonine kinases upon ligand binding. Type II receptors initiate a signaling cascade that phosphorylates and activates type I receptors, which become autophosphorylated. AMHR2/MISRII Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant cynomolgus, Rhesus Macaque-derived AMHR2/MISRII protein, expressed by HEK293 , with C-His labeled tag. The total length of AMHR2/MISRII Protein, Cynomolgus/Rhesus macaque (HEK293, His) is 127 a.a., with molecular weight of 20-30 kDa.

Upon ligand binding, AMHR2/MISRII Protein orchestrates the assembly of a receptor complex, comprising two type II and two type I transmembrane serine/threonine kinases. The type II receptors initiate the signaling cascade by phosphorylating and activating the type I receptors, which, in turn, undergo autophosphorylation. Subsequently, these activated type I receptors engage with and activate SMAD transcriptional regulators, culminating in the modulation of downstream gene expression. Notably, AMHR2/MISRII functions as the receptor for anti-Muellerian hormone, playing a pivotal role in mediating the cellular responses triggered by this hormone.

Cynomolgus; Rhesus Macaque

HEK293

C-His

A0A2K5U1R9 (P18-S144)

/

PPNRRTCVFFEAPGVQGSTKTLGELLDTGPELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

20-30 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.