Aminoacylase-1 Protein, Mouse (HEK293, His)

The Aminoacylase-1 protein plays an important role in cellular processes as it catalyzes the hydrolysis of N-acetylated amino acids, promoting the conversion of these compounds into acetate and free amino acids. This enzymatic activity highlights the importance of Aminoacylase-1 in the metabolic pathways responsible for the breakdown of N-acetylated amino acids, helping to release essential amino acids and acetate as by-products. Aminoacylase-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Aminoacylase-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Aminoacylase-1 Protein, Mouse (HEK293, His) is 408 a.a., with molecular weight of ~55 kDa.

Aminoacylase-1 is an enzyme that catalyzes the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. This enzymatic activity is part of the process of amino acid metabolism, where N-acetylated amino acids are cleaved to release the corresponding amino acids and acetate. Aminoacylase-1's role in this hydrolytic reaction contributes to the regulation of amino acid levels and is essential for maintaining cellular homeostasis. This enzyme plays a key part in the intricate network of metabolic pathways governing amino acid utilization and is involved in processes such as protein synthesis and energy production.

Measured by its ability to cleave N-acetyl-L-Methione (Ac-Met). The specific activity is 19928.580 pmol/min/µg.

Mouse

HEK293

C-His

Q99JW2 (M1-S408)

109652  [NCBI]

MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALAS

Approximately 55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.