1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. AMSH Protein, Human

AMSH is a zinc metalloprotease that selectively cleaves "Lys-63"-linked polyubiquitin chains, but not "Lys-48"-linked chains. It plays a critical regulatory role in signaling in IL-2 and GM-CSF mediated pathways, acting as a positive BMP signaling modulator against SMAD6 and SMAD7 inhibition. AMSH Protein, Human is the recombinant human-derived AMSH protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AMSH is a zinc metalloprotease that selectively cleaves "Lys-63"-linked polyubiquitin chains, but not "Lys-48"-linked chains. It plays a critical regulatory role in signaling in IL-2 and GM-CSF mediated pathways, acting as a positive BMP signaling modulator against SMAD6 and SMAD7 inhibition. AMSH Protein, Human is the recombinant human-derived AMSH protein, expressed by E. coli , with tag free.

Background

AMSH is a zinc metalloprotease with a specific affinity for cleaving 'Lys-63'-linked polyubiquitin chains, excluding 'Lys-48'-linked polyubiquitin chains. It plays a crucial role in signal transduction associated with cell growth, particularly in the context of IL-2 and GM-CSF-mediated pathways. Additionally, AMSH acts as a positive regulator of BMP signaling by counteracting the inhibitory effects of SMAD6 and SMAD7. The protein is instrumental in orchestrating cell surface receptor-mediated endocytosis, facilitating ubiquitin-dependent sorting of receptors to lysosomes. While the endosomal localization of AMSH is vital for efficient EGFR degradation, it is dispensable for receptor internalization. Moreover, AMSH is intricately involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O95630 (S2-R424)

Gene ID

10617

Molecular Construction
N-term
AMSH (S2-R424)
Accession # O95630
C-term
Protein Length

Full Length

Synonyms
STAMBP; STAM-binding protein; Associated molecule with the SH3 domain of STAM; Endosome-associated ubiquitin isopeptidase
AA Sequence

SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYSEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

Purity

≥85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

AMSH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AMSH Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMSH Protein, Human
Cat. No.:
HY-P701458
Quantity:
MCE Japan Authorized Agent: