1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. AMY2A Protein, Rhesus Macaque (HEK293, Fc)

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived AMY2A protein, expressed by HEK293 , with C-hFc labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived AMY2A protein, expressed by HEK293 , with C-hFc labeled tag.

Background

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases[1][2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

H9EX43 (Q16-L511)

Gene ID
Molecular Construction
N-term
AMY2A (Q16-L511)
Accession # H9EX43
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Pancreatic alpha-amylase; PA; 1,4-alpha-D-glucan glucanohydrolase
AA Sequence

QYSPNTQQGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPPNENVAIHNPSRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTSSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSEIAEYMNKLIDMGVAGFRLDASKHMWPGDIKAVLDKLHNLNSNWFPQGSKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRNFQNGKDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQPFTNWYDNGSNQVAFGRGNKGFIVFNNDDWSFSSTLQTGLPAGTYCDVISGDKIDGNCTGIKIYVSNDGKAQFSISNSAEDPFIAIHVESKL

Predicted Molecular Mass
82.8 kDa
Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation

AMY2A Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

AMY2A Protein, Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
AMY2A Protein, Rhesus Macaque (HEK293, Fc)
Art. -Nr.:
HY-P76723
Menge:
MCE Japan Authorized Agent: