Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar)

The angiopoietin-4 protein has specific bactericidal activity against Enterococcus faecalis and Listeria monocytogenes, distinct from its lack of efficacy against Lactobacillus innocua and Escherichia coli. Furthermore, Angiogenin-4 exerts pro-angiogenic effects in vitro, suggesting its involvement in supporting the formation of new blood vessels. Angiogenin-4 Protein, Mouse (P.pastoris) is the recombinant mouse-derived Angiogenin-4 protein, expressed by P. pastoris , with N-6*His, N-SUMO labeled tag. The total length of Angiogenin-4 Protein, Mouse (P.pastoris) is 120 a.a., with molecular weight of ~33 kDa.

Angiogenin-4 (ANG4), .exhibits notable bactericidal activity against E. faecalis and L. monocytogenes, distinguishing its antimicrobial effects. However, it does not demonstrate bactericidal activity against L. innocua and E. coli. Besides its antimicrobial role, ANG4 also plays a role in promoting angiogenesis in vitro, showcasing its involvement in the formation of new blood vessels. Despite having low ribonuclease activity in vitro, ANG4 stands out in its ability to stimulate the proliferation of melanoma cells, while showing no such effect on endothelial cells or fibroblasts in vitro. These multifaceted functions of ANG4 highlight its diverse roles in host defense, angiogenesis, and cell proliferation, suggesting potential implications for therapeutic strategies targeting infections and cancer. Further research is essential to unravel the specific molecular mechanisms underlying these activities.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

P. pastoris

N-6*His;N-SUMOstar

Q3TMQ6 (Q25-P144)

219033  [NCBI]

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Approximately 33 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.