Copy Link Print Information

Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar)

Customer Review

Based on 1 Customer Validation

The angiopoietin-4 protein has specific bactericidal activity against Enterococcus faecalis and Listeria monocytogenes, distinct from its lack of efficacy against Lactobacillus innocua and Escherichia coli. Furthermore, Angiogenin-4 exerts pro-angiogenic effects in vitro, suggesting its involvement in supporting the formation of new blood vessels. Angiogenin-4 Protein, Mouse (P.pastoris) is the recombinant mouse-derived Angiogenin-4 protein, expressed by P. pastoris , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The angiopoietin-4 protein has specific bactericidal activity against Enterococcus faecalis and Listeria monocytogenes, distinct from its lack of efficacy against Lactobacillus innocua and Escherichia coli. Furthermore, Angiogenin-4 exerts pro-angiogenic effects in vitro, suggesting its involvement in supporting the formation of new blood vessels. Angiogenin-4 Protein, Mouse (P.pastoris) is the recombinant mouse-derived Angiogenin-4 protein, expressed by P. pastoris , with N-6*His, N-SUMO labeled tag.

Background

Angiogenin-4 (ANG4), .exhibits notable bactericidal activity against E. faecalis and L. monocytogenes, distinguishing its antimicrobial effects. However, it does not demonstrate bactericidal activity against L. innocua and E. coli. Besides its antimicrobial role, ANG4 also plays a role in promoting angiogenesis in vitro, showcasing its involvement in the formation of new blood vessels. Despite having low ribonuclease activity in vitro, ANG4 stands out in its ability to stimulate the proliferation of melanoma cells, while showing no such effect on endothelial cells or fibroblasts in vitro. These multifaceted functions of ANG4 highlight its diverse roles in host defense, angiogenesis, and cell proliferation, suggesting potential implications for therapeutic strategies targeting infections and cancer. Further research is essential to unravel the specific molecular mechanisms underlying these activities.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-6*His;N-SUMOstar
  • Accession

    Q3TMQ6 (Q25-P144)

  • Gene ID
    219033  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMOstar
    • Angiogenin-4 (Q25-P144)
      Accession # Q3TMQ6
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ANGPT4; ANG4; Angiopoietin 4; Angiopoietin-3; Angiopoietin-4; ANG-3; ANG3; ANG-4

  • AA Sequence

    QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

  • Predicted Molecular Mass

    29.9 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar) Product Image
    1/16
  • Angiogenin-4 Protein, Mouse (P.pastoris, His-SUMOstar) Product Image