1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-1
  5. Angiopoietin-1 Protein, Cynomolgus (HEK293, His)

Angiopoietin-1 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76146
Handling Instructions Technical Support

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. Angiopoietin-1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. Angiopoietin-1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Angiopoietin-1 protein, expressed by HEK293 , with N-His labeled tag.

Background

ANGPT1 encodes a secreted glycoprotein in the angiopoietin family and is a key ligand in the vasotyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. The Angiopoietin-1 Protein regulates the formation and stability of blood vessels and plays an important role in vascular development. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells[1][2][3].

Biological Activity

Determined by its ability to induce adhesion of human umbilical vein endothelial cells (HUVEC).The ED50 for this effect is 258.6 ng/mL, corresponding to a specific activity is 3.867×103 units/mg.

  • Determined by its ability to induce adhesion of human umbilical vein endothelial cells (HUVEC).The ED50 for this effect is 258.6 ng/mL, corresponding to a specific activity is 3.867×103 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

N-6*His

Accession

XP_005563980 (R276-F497)

Gene ID
Molecular Construction
N-term
His
Angiopoietin-1 (R277-F498)
Accession # XP_005563980
C-term
Protein Length

Partial

Synonyms
AGP1; AGPT; ANG-1; Angiopoietin-1; ANGPT1
AA Sequence

REEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Molecular Weight

Approximately 30-34 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Angiopoietin-1 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Angiopoietin-1 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-1 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76146
Quantity:
MCE Japan Authorized Agent: