ANGPTL4/Angiopoietin-related 4 Protein, Mouse (HEK293, Fc, solution)

Angiopoietin-related protein 4/ANGPTL4 Protein, Mouse (HEK293, Fc) expresses in HEK293 with an Fc fragment at the C-terminus. Angiopoietin-Related Protein 4 (ANGPTL4) is a multifunctional cytokine regulating vascular permeability, angiogenesis, and inflammation^[1].

Angiopoietin-Related Protein 4 (ANGPTL4) is a secreted protein and a member of a family of angiopoietin-like proteins (ANGPTL1-8)^[1].

Mouse

HEK293

C-hFc

Q9Z1P8 (K167-S410)

57875  [NCBI]

Partial

KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Approximately 70.0 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filter solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Xinyue Yang, et al. A Review of the Multifunctionality of Angiopoietin-Like 4 in Eye Disease. Biosci Rep. 2018 Sep 13;38(5):BSR20180557.  [Content Brief]