1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. Angiopoietin Like 4
  5. ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His)

ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P700655
Handling Instructions Technical Support

ANGPTL4/angiopoietin-related 4 protein plays a key role in regulating lipid metabolism by inactivating lipoprotein lipase (LPL) and controlling the clearance of triglycerides in the blood. Its effects extend to the regulation of glucose homeostasis and insulin sensitivity. ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ANGPTL4/angiopoietin-related 4 protein plays a key role in regulating lipid metabolism by inactivating lipoprotein lipase (LPL) and controlling the clearance of triglycerides in the blood. Its effects extend to the regulation of glucose homeostasis and insulin sensitivity. ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by HEK293 , with N-His labeled tag.

Background

ANGPTL4/Angiopoietin-related 4 Protein assumes a pivotal role in the intricate regulation of lipid metabolism by mediating the inactivation of lipoprotein lipase (LPL), thereby contributing to the control of triglyceride clearance from the bloodstream. Beyond its involvement in lipid metabolism, ANGPTL4 may also play a crucial part in regulating glucose homeostasis and insulin sensitivity. Moreover, it exerts inhibitory effects on endothelial cells by impeding proliferation, migration, and tubule formation, ultimately reducing vascular leakage. In vitro studies demonstrate that ANGPTL4, when expressed heterologously, hampers endothelial cell adhesion to the extracellular matrix (ECM), inhibits the reorganization of the actin cytoskeleton, and disrupts the formation of actin stress fibers and focal adhesions. Additionally, ANGPTL4's cleaved form exhibits higher activity in LPL inactivation compared to the uncleaved protein, further emphasizing its multifaceted role in lipid homeostasis and endothelial cell function. Depending on the context, ANGPTL4 may also modulate tumor-related angiogenesis, underscoring its contextual influence on diverse physiological processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus Angiopoietin-like 4/ANGPTL4 at 2 μg/mL (100 μL/well) on the plate can bind Biotinylated Human CD85d (HY-P70168). The ED50 for this effect is 162.6 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus Angiopoietin-like 4/ANGPTL4 at 2 μg/mL (100 μL/well) on the plate can bind Biotinylated Human CD85d (HY-P70168). The ED50 for this effect is 162.6 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

XP_045236104.1 (R164-S406)

Gene ID
Molecular Construction
N-term
8*His
ANGPTL4 (R164-S406)
Accession # XP_045236104.1
C-term
Protein Length

Partial

Synonyms
ANGPTL4; ARP4; FIAF; HFARP; Angiopoietin like 4; NGPTL2; NL2; PGAR; pp1158; ANG-3; ANG4; AGP4; ANG3; ANG-3; ANG-4;
AA Sequence

RRPEMAQPVDSAHNASRLHRLPRDCQELFEDGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPQGEFWLGLEKVHSITGDRNSRLAVQLQDWDGNAESLQFSVHLGGEDTAYSLQLTEPVASQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQELKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS

Molecular Weight

35-40 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ANGPTL4/Angiopoietin-related 4 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700655
Quantity:
MCE Japan Authorized Agent: