ANGPTL4/Angiopoietin-related 4 Protein, Mouse (HEK293, His)

ANGPTL4/angiopoietin-related 4 protein plays a key role in regulating lipid metabolism by inactivating lipoprotein lipase (LPL) and controlling the clearance of triglycerides in the blood. Its effects extend to the regulation of glucose homeostasis and insulin sensitivity. ANGPTL4/Angiopoietin-related 4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ANGPTL4/Angiopoietin-related 4 protein, expressed by HEK293 , with N-His labeled tag.

ANGPTL4/Angiopoietin-related 4 Protein assumes a pivotal role in the intricate regulation of lipid metabolism by mediating the inactivation of lipoprotein lipase (LPL), thereby contributing to the control of triglyceride clearance from the bloodstream. Beyond its involvement in lipid metabolism, ANGPTL4 may also play a crucial part in regulating glucose homeostasis and insulin sensitivity. Moreover, it exerts inhibitory effects on endothelial cells by impeding proliferation, migration, and tubule formation, ultimately reducing vascular leakage. In vitro studies demonstrate that ANGPTL4, when expressed heterologously, hampers endothelial cell adhesion to the extracellular matrix (ECM), inhibits the reorganization of the actin cytoskeleton, and disrupts the formation of actin stress fibers and focal adhesions. Additionally, ANGPTL4's cleaved form exhibits higher activity in LPL inactivation compared to the uncleaved protein, further emphasizing its multifaceted role in lipid homeostasis and endothelial cell function. Depending on the context, ANGPTL4 may also modulate tumor-related angiogenesis, underscoring its contextual influence on diverse physiological processes.

Mouse

HEK293

N-8*His

Q9Z1P8 (R168-S410)

57875  [NCBI]

Partial

RLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

35-50 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/g-402-cell.html