Animal-Free Annexin A5/ANXA5 Protein, Human (His)

Annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex in the coagulation cascade. ANXA5 exists as a monomer and its role is not limited to coagulation regulation, but also has binding interactions involving ATRX and EIF5B, suggesting its involvement in a variety of cells. Animal-Free Annexin A5/ANXA5 Protein, Human (His) is the recombinant human-derived animal-FreeAnnexin A5/ANXA5 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free Annexin A5/ANXA5 Protein, Human (His) is 320 a.a., with molecular weight of ~36.75 kDa.

Annexin A5 (ANXA5) protein functions as an anticoagulant, serving as an indirect inhibitor of the thromboplastin-specific complex crucial in the blood coagulation cascade. Structurally, ANXA5 exists as a monomer, and its role extends beyond coagulation regulation. It exhibits binding interactions with ATRX and EIF5B, suggesting involvement in diverse cellular processes. Notably, ANXA5 interacts with the hepatitis B virus (HBV), indicating a potential role in viral interactions. The multifaceted attributes of ANXA5 underscore its significance in cellular regulation, offering potential insights into both hemostasis and its involvement in interactions with viral pathogens such as HBV.

Human

E. coli

C-His

P08758 (M1-D320)

308  [NCBI]

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Approximately 36.75 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.