Copy Link Print Information

Animal-Free FGF-9 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free FGF-9 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The FGF-9 protein plays a key role in embryonic development, controlling cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth and differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promotion of glioma growth. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

FGF-9 Protein assumes a pivotal role in governing embryonic development, cell proliferation, differentiation, and migration. Its involvement extends to diverse processes, including glial cell growth and differentiation during development, gliosis in the brain's repair and regeneration after injury, differentiation and survival of neuronal cells, and the promotion of growth in glial tumors. Operating as a monomer or homodimer, FGF-9 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for diverse cellular responses. The binding affinity between FGF-9 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors. These interactions underscore the multifaceted and indispensable role of FGF-9 in orchestrating crucial cellular events across various physiological contexts.

Verified Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P31371 (M1-S208)

  • Gene ID
    2254  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-9 (M1-S208)
      Accession # P31371
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FGF9; FGF-9; Fibroblast Growth Factor 9; GAF; Fibroblast Growth Factor 9 (Glia-Activating Factor); Fibroblast Growth Factor; Heparin-Binding Growth Factor 9; HBFG-9; Glia-Activating Factor; SYNS3; HBGF-9; FGF

  • AA Sequence

    MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Predicted Molecular Mass

    22.1 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free FGF-9 Protein, Human (His) Product Image
    1/16
  • Animal-Free FGF-9 Protein, Human (His) Product Image