Animal-Free FGF-9 Protein, Human (His)

FGF-9 Protein plays a pivotal role in embryonic development, governing cell proliferation, differentiation, and migration. Its diverse functions include glial cell growth, differentiation, gliosis in brain repair, neuronal cell differentiation and survival, and promoting growth in glial tumors. Operating as a monomer or homodimer, FGF-9 engages in intricate interactions with FGFRs, forming critical molecular alliances for diverse cellular responses. The potentiated binding affinity with heparan sulfate glycosaminoglycans highlights FGF-9's indispensable role in orchestrating crucial cellular events. Animal-Free FGF-9 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-9 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-9 Protein, Human (His) is 208 a.a., with molecular weight of ~22.14 kDa.

FGF-9 Protein assumes a pivotal role in governing embryonic development, cell proliferation, differentiation, and migration. Its involvement extends to diverse processes, including glial cell growth and differentiation during development, gliosis in the brain's repair and regeneration after injury, differentiation and survival of neuronal cells, and the promotion of growth in glial tumors. Operating as a monomer or homodimer, FGF-9 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for diverse cellular responses. The binding affinity between FGF-9 and its receptors is potentiated by heparan sulfate glycosaminoglycans, acting as essential coreceptors. These interactions underscore the multifaceted and indispensable role of FGF-9 in orchestrating crucial cellular events across various physiological contexts.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <2 ng/mL.

Human

E. coli

C-His

P31371 (M1-S208)

2254  [NCBI]

MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Approximately 22.14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.