Animal-Free Galectin-13 Protein, Human (His)

Galectin-13 Protein, with beta-galactoside and lactose binding capacity, acts as a potent inducer of T-cell apoptosis, as confirmed by research findings. It also exhibits hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, maintained by disulfide linkages contributing to its dimeric form. Animal-Free Galectin-13 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

The Galectin-13 Protein exhibits the capacity to bind to beta-galactoside and lactose, and it functions as a potent inducer of T-cell apoptosis, as supported by research findings. Additionally, this protein demonstrates hemagglutinating activity towards chicken erythrocytes, as reported in studies. Structurally, Galectin-13 Protein exists as a homodimer, with disulfide linkages contributing to its dimeric form.

Human

E. coli

N-6*His

Q9UHV8 (S2-N139)

29124  [NCBI]

Partial

SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Approximately 17 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.