1. Recombinant Proteins
  2. Animal-free Recombinant Proteins
  3. Animal-Free Galectin-3/LGALS3 Protein, Human (His)

Animal-Free Galectin-3/LGALS3 Protein, Human (His)

Cat. No.: HY-P700079AF
COA Handling Instructions

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Animal-Free Galectin-3/LGALS3 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-3/LGALS3 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Galectin-3/LGALS3 Protein, Human (His) is 249 a.a., with molecular weight of ~27 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $44 In-stock
10 μg $122 In-stock
50 μg $340 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Animal-Free Galectin-3/LGALS3 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-3/LGALS3 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free Galectin-3/LGALS3 Protein, Human (His) is 249 a.a., with molecular weight of ~27 kDa.

Background

The Galectin-3/LGALS3 Protein is a galactose-specific lectin known for its versatile roles in cellular processes. It binds IgE and, in collaboration with the alpha-3, beta-1 integrin, facilitates CSPG4-induced migration of endothelial cells. Together with DMBT1, it is crucial for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, the protein serves as a pre-mRNA splicing factor and is actively involved in acute inflammatory responses, influencing neutrophil activation, adhesion, chemoattraction of monocytes and macrophages, opsonization of apoptotic neutrophils, and mast cell activation. Its partnership with TRIM16 allows for the coordinated recognition of membrane damage, triggering the mobilization of core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and engages with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, UACA, TRIM16, and TMED10, facilitating diverse cellular interactions, including autophagy and secretion.

Biological Activity

Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <8 µg/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P17931 (A2-I250)

Gene ID
Molecular Construction
N-term
His
LGALS3 (A2-I250)
Accession # P17931
C-term
Synonyms
Galectin-3; Gal-3; 35 kDa Lectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; Galactoside-Binding Protein; GALBP; IgE-Binding Protein; L-31; Laminin-Binding Protein; Lectin L-29; Mac-2 Antigen; LGALS3; MAC2
AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Molecular Weight

Approximately 27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free Galectin-3/LGALS3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free Galectin-3/LGALS3 Protein, Human (His)
Cat. No.:
HY-P700079AF
Quantity:
MCE Japan Authorized Agent: