Animal-Free GM-CSF Protein, Pig (His)

The GM-CSF protein acts as a potent cytokine that coordinates the growth and differentiation of hematopoietic precursor cells of different lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer and its signaling is mediated through a dodecamer complex. Animal-Free GM-CSF Protein, Pig (His) is the recombinant pig-derived animal-FreeGM-CSF protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

GM-CSF Protein serves as a potent cytokine, orchestrating the growth and differentiation of hematopoietic precursor cells across diverse lineages, including granulocytes, macrophages, eosinophils, and erythrocytes. Structurally, GM-CSF exists as a monomer, and its signaling is mediated through a dodecameric complex. This complex comprises two head-to-head hexamers, each featuring two alpha, two beta, and two ligand subunits, underscoring the intricacy of the receptor assembly and the specificity of GM-CSF in modulating cellular responses.

Measure by its ability to induce proliferationin TF-1 cells. The ED₅₀ for this effect is <3 ng/mL.

• 
  Measure by its ability to induce proliferationin TF-1 cells. The ED₅₀ for this effect is 0.212 ng/mL.

Pig

E. coli

N-6*His

Q29118 (A18-K144)

397208  [NCBI]

Full Length of Mature Protein

APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU/μg, determined by LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.