1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interferon & Receptors
  4. IFN-γ
  5. Animal-Free IFN-gamma Protein, Human (His)

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. Animal-Free IFN-gamma Protein, Human (His) is the recombinant human-derived animal-FreeIFN-gamma protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. Animal-Free IFN-gamma Protein, Human (His) is the recombinant human-derived animal-FreeIFN-gamma protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells[1][2][3][4][5].

Biological Activity

Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 106 IU/mg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P01579 (Q24-Q166)

Gene ID
Molecular Construction
N-term
IFN-gamma (Q24-Q166)
Accession # P01579
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFNG; IFN-gamma; Interferon gamma
AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Predicted Molecular Mass
17.7 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Animal-Free IFN-gamma Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Animal-Free IFN-gamma Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IFN-gamma Protein, Human (His)
Cat. No.:
HY-P700091AF
Quantity:
MCE Japan Authorized Agent: