Animal-Free IGF2 Protein, Human (His)
Based on 1 Customer Validation
The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. Animal-Free IGF2 Protein, Human (His) is the recombinant human-derived animal-FreeIGF2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGF2 protein is an important member of the insulin-like growth factor family and plays an important role in mammalian growth, fetoplacental development, and adult glucose metabolism. Regulated by placental prolactin, affecting tissue differentiation. Animal-Free IGF2 Protein, Human (His) is the recombinant human-derived animal-FreeIGF2 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.
Background
The IGF2 protein, a member of the insulin-like growth factor family, plays a pivotal role in promoting growth and influencing fetoplacental development, particularly as a major fetal growth hormone in mammals. It is regulated by placental lactogen and contributes to tissue differentiation. In adults, IGF2 is involved in glucose metabolism in adipose tissue, skeletal muscle, and the liver. Acting as a ligand for integrin, it facilitates IGF2 signaling and positively regulates the function of the myogenic transcription factor MYOD1, controlling muscle terminal differentiation. Additionally, IGF2 inhibits myoblast differentiation and modulates metabolism by increasing mitochondrial respiration rates. Moreover, in glucose-mediated co-secretion with insulin, IGF2's counterpart, preptin, acts as a physiological amplifier of glucose-mediated insulin secretion. Notably, IGF2 exhibits osteogenic properties, enhancing osteoblast mitogenic activity through the phosphoactivation of MAPK1 and MAPK3.
Verified Bioactivity
Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <3 ng/mL. The specific activity of recombinant human IGF-II is >3x105 IU/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P01344-1 (A25-E91)
-
Molecular Construction
-
N-term
-
6*His
-
IGF2 (A25-E91)
Accession # P01344-1 -
C-term
-
-
Protein Length
Full Length of IGF2 Chain
-
Synonyms
IGF2; Insulin-Like Growth Factor 2 (Somatomedin A); Prev. C11orf43; Insulin-Like Growth Factor Type 2; Insulin-Like Growth Factor 2; Somatomedin A; IGF-II; Somatomedin-A; Insulin-Like Growth Factor II; PP9974; T3M-11-Derived Growth Factor; IGF-2; FLJ44734
-
AA Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
-
Predicted Molecular Mass
8.3 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
