Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His)

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways. Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 alpha/IL-1F1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 alpha/IL-1F1 Protein, Pig (His) is 158 a.a., with molecular weight of ~19.02 kDa.

The cytokine interleukin-1 alpha (IL-1 alpha), constitutively present intracellularly in almost all quiescent non-hematopoietic cells, plays a crucial role in inflammation and serves as a key mediator bridging the innate and adaptive immune systems. Upon binding to its receptor IL1R1, along with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This activation leads to the subsequent activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. In addition to its role as a danger signal during cell necrosis, IL-1 alpha directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-1 alpha interacts with IL1R1 and S100A13, with the latter interaction being the initial step in the export of IL-1 alpha, followed by the direct translocation of this complex across the plasma membrane.

Pig

E. coli

C-His

P18430 (S113-S270)

397094  [NCBI]

MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Approximately 19.02 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.